BLASTX nr result
ID: Rehmannia31_contig00018606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018606 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842740.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [E... 78 2e-13 gb|EYU32939.1| hypothetical protein MIMGU_mgv1a003371mg [Erythra... 78 2e-13 ref|XP_011078441.1| protein tesmin/TSO1-like CXC 5 [Sesamum indi... 73 9e-12 ref|XP_011093606.1| protein tesmin/TSO1-like CXC 5 [Sesamum indi... 72 2e-11 gb|PIN08303.1| Metallothionein-like protein [Handroanthus impeti... 67 2e-09 gb|KZV27468.1| hypothetical protein F511_02577 [Dorcoceras hygro... 59 7e-07 >ref|XP_012842740.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [Erythranthe guttata] Length = 580 Score = 77.8 bits (190), Expect = 2e-13 Identities = 38/42 (90%), Positives = 39/42 (92%), Gaps = 1/42 (2%) Frame = -2 Query: 125 MEQREGGDFPPK-KPTPQSEASSTAPGDFPARKLVRQLDFTG 3 MEQREGGDFPPK +P PQSEASSTAP DFPARKLVRQLDFTG Sbjct: 1 MEQREGGDFPPKNQPPPQSEASSTAPADFPARKLVRQLDFTG 42 >gb|EYU32939.1| hypothetical protein MIMGU_mgv1a003371mg [Erythranthe guttata] Length = 589 Score = 77.8 bits (190), Expect = 2e-13 Identities = 38/42 (90%), Positives = 39/42 (92%), Gaps = 1/42 (2%) Frame = -2 Query: 125 MEQREGGDFPPK-KPTPQSEASSTAPGDFPARKLVRQLDFTG 3 MEQREGGDFPPK +P PQSEASSTAP DFPARKLVRQLDFTG Sbjct: 1 MEQREGGDFPPKNQPPPQSEASSTAPADFPARKLVRQLDFTG 42 >ref|XP_011078441.1| protein tesmin/TSO1-like CXC 5 [Sesamum indicum] Length = 601 Score = 73.2 bits (178), Expect = 9e-12 Identities = 36/42 (85%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -2 Query: 125 MEQREGGDFPPKK-PTPQSEASSTAPGDFPARKLVRQLDFTG 3 M+Q+EGGDFPPKK P PQS ASSTAP DFPARKLVRQLDFTG Sbjct: 1 MDQKEGGDFPPKKQPPPQSGASSTAPVDFPARKLVRQLDFTG 42 >ref|XP_011093606.1| protein tesmin/TSO1-like CXC 5 [Sesamum indicum] Length = 611 Score = 72.0 bits (175), Expect = 2e-11 Identities = 37/43 (86%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -2 Query: 125 MEQREGGDFPPKK--PTPQSEASSTAPGDFPARKLVRQLDFTG 3 MEQ EGGDFPPKK P PQSEASSTA DFPARKLVRQLDFTG Sbjct: 1 MEQSEGGDFPPKKQPPPPQSEASSTAGVDFPARKLVRQLDFTG 43 >gb|PIN08303.1| Metallothionein-like protein [Handroanthus impetiginosus] Length = 596 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/41 (85%), Positives = 35/41 (85%) Frame = -2 Query: 125 MEQREGGDFPPKKPTPQSEASSTAPGDFPARKLVRQLDFTG 3 MEQREGGD PPKK QSEASSTA DFPARKLVRQLDFTG Sbjct: 1 MEQREGGDLPPKKAL-QSEASSTAGVDFPARKLVRQLDFTG 40 >gb|KZV27468.1| hypothetical protein F511_02577 [Dorcoceras hygrometricum] Length = 543 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -2 Query: 125 MEQREGGDFPPKKPTPQSEASST-APGDFPARKLVRQLDFTG 3 MEQREGG+F PK QSE S+T A DFPARKLVRQLDFTG Sbjct: 1 MEQREGGEFLPKNRPSQSEDSATPAAADFPARKLVRQLDFTG 42