BLASTX nr result
ID: Rehmannia31_contig00018509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018509 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100286.1| UPF0481 protein At3g47200 [Sesamum indicum] ... 100 4e-22 >ref|XP_011100286.1| UPF0481 protein At3g47200 [Sesamum indicum] ref|XP_020555017.1| UPF0481 protein At3g47200 [Sesamum indicum] ref|XP_020555018.1| UPF0481 protein At3g47200 [Sesamum indicum] ref|XP_020555019.1| UPF0481 protein At3g47200 [Sesamum indicum] Length = 437 Score = 99.8 bits (247), Expect = 4e-22 Identities = 61/120 (50%), Positives = 81/120 (67%) Frame = +1 Query: 1 QDYKDFGTSTLVGNTEKVPFLTLQQDLLKIENQLPFNVLKHLADLALSNNSQSFSQGNTK 180 Q+ KD S LVG +EKV TLQQDLLKIENQ+PF VL+ L+DL +N QGNTK Sbjct: 140 QESKDSNDS-LVGRSEKVSVHTLQQDLLKIENQIPFFVLETLSDLTWTNQEPPPPQGNTK 198 Query: 181 TPENKNPTLIELALKFFNISKPESFKIDNPRHLLELAMNALFHKTDQDPNQDPSAQTIQV 360 + + K LI LAL FF + ++ IDNPRHLL+LA+ +LFH+ +QD + +++IQV Sbjct: 199 SNKQK---LISLALDFFGVELKDT-TIDNPRHLLDLALKSLFHE-NQDSSLQQDSRSIQV 253