BLASTX nr result
ID: Rehmannia31_contig00018411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018411 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN12421.1| hypothetical protein CDL12_14972 [Handroanthus im... 97 3e-24 >gb|PIN12421.1| hypothetical protein CDL12_14972 [Handroanthus impetiginosus] Length = 51 Score = 96.7 bits (239), Expect = 3e-24 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -2 Query: 229 MEMIAVEESSFLMVYCYAIGGGMVAGKRIARRFVKTFIIPTVPRSCKFRVF 77 MEMIA+EESSFLMVYCYAIGG M AGKRI RRFVKTFIIPTVPRSCKFRV+ Sbjct: 1 MEMIALEESSFLMVYCYAIGGWMAAGKRITRRFVKTFIIPTVPRSCKFRVY 51