BLASTX nr result
ID: Rehmannia31_contig00018395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018395 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847397.1| PREDICTED: chloride channel protein CLC-e-li... 66 4e-10 gb|EYU29400.1| hypothetical protein MIMGU_mgv1a003562mg [Erythra... 65 6e-10 ref|XP_012846915.1| PREDICTED: chloride channel protein CLC-e-li... 65 7e-10 ref|XP_020551074.1| chloride channel protein CLC-e isoform X3 [S... 58 2e-07 ref|XP_011085094.1| chloride channel protein CLC-e isoform X1 [S... 58 2e-07 >ref|XP_012847397.1| PREDICTED: chloride channel protein CLC-e-like [Erythranthe guttata] Length = 778 Score = 66.2 bits (160), Expect = 4e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMPEKFK 116 RG CPVGLLDRESIDLA RAFA++EGLSWF + EKFK Sbjct: 741 RGGCPVGLLDRESIDLACRAFAIQEGLSWFLVQEKFK 777 >gb|EYU29400.1| hypothetical protein MIMGU_mgv1a003562mg [Erythranthe guttata] Length = 578 Score = 65.5 bits (158), Expect = 6e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMPEKF 113 RG CPVGLLDRESIDLA RAFA +EGLSWFF+ EKF Sbjct: 541 RGGCPVGLLDRESIDLACRAFATQEGLSWFFVQEKF 576 >ref|XP_012846915.1| PREDICTED: chloride channel protein CLC-e-like [Erythranthe guttata] Length = 751 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMPEKF 113 RG CPVGLLDRESIDLA RAFA +EGLSWFF+ EKF Sbjct: 714 RGGCPVGLLDRESIDLACRAFATQEGLSWFFVQEKF 749 >ref|XP_020551074.1| chloride channel protein CLC-e isoform X3 [Sesamum indicum] Length = 579 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 9 GSCPVGLLDRESIDLARRAFAVREGLSWFFMPEKFKN 119 G CPVGLLDRESIDLA RA+AVREGL+W E FK+ Sbjct: 543 GGCPVGLLDRESIDLACRAYAVREGLNWCLTRENFKS 579 >ref|XP_011085094.1| chloride channel protein CLC-e isoform X1 [Sesamum indicum] Length = 802 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 9 GSCPVGLLDRESIDLARRAFAVREGLSWFFMPEKFKN 119 G CPVGLLDRESIDLA RA+AVREGL+W E FK+ Sbjct: 766 GGCPVGLLDRESIDLACRAYAVREGLNWCLTRENFKS 802