BLASTX nr result
ID: Rehmannia31_contig00018394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018394 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847397.1| PREDICTED: chloride channel protein CLC-e-li... 69 5e-11 gb|EYU29400.1| hypothetical protein MIMGU_mgv1a003562mg [Erythra... 68 9e-11 ref|XP_012846915.1| PREDICTED: chloride channel protein CLC-e-li... 68 1e-10 ref|XP_020551074.1| chloride channel protein CLC-e isoform X3 [S... 59 9e-08 ref|XP_011085094.1| chloride channel protein CLC-e isoform X1 [S... 59 9e-08 gb|PIN13191.1| Cl- channel CLC-3 and related proteins (CLC super... 55 2e-06 >ref|XP_012847397.1| PREDICTED: chloride channel protein CLC-e-like [Erythranthe guttata] Length = 778 Score = 68.6 bits (166), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMQEKFK 116 RG CPVGLLDRESIDLA RAFA++EGLSWF +QEKFK Sbjct: 741 RGGCPVGLLDRESIDLACRAFAIQEGLSWFLVQEKFK 777 >gb|EYU29400.1| hypothetical protein MIMGU_mgv1a003562mg [Erythranthe guttata] Length = 578 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMQEKF 113 RG CPVGLLDRESIDLA RAFA +EGLSWFF+QEKF Sbjct: 541 RGGCPVGLLDRESIDLACRAFATQEGLSWFFVQEKF 576 >ref|XP_012846915.1| PREDICTED: chloride channel protein CLC-e-like [Erythranthe guttata] Length = 751 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 6 RGSCPVGLLDRESIDLARRAFAVREGLSWFFMQEKF 113 RG CPVGLLDRESIDLA RAFA +EGLSWFF+QEKF Sbjct: 714 RGGCPVGLLDRESIDLACRAFATQEGLSWFFVQEKF 749 >ref|XP_020551074.1| chloride channel protein CLC-e isoform X3 [Sesamum indicum] Length = 579 Score = 59.3 bits (142), Expect = 9e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 9 GSCPVGLLDRESIDLARRAFAVREGLSWFFMQEKFKN 119 G CPVGLLDRESIDLA RA+AVREGL+W +E FK+ Sbjct: 543 GGCPVGLLDRESIDLACRAYAVREGLNWCLTRENFKS 579 >ref|XP_011085094.1| chloride channel protein CLC-e isoform X1 [Sesamum indicum] Length = 802 Score = 59.3 bits (142), Expect = 9e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 9 GSCPVGLLDRESIDLARRAFAVREGLSWFFMQEKFKN 119 G CPVGLLDRESIDLA RA+AVREGL+W +E FK+ Sbjct: 766 GGCPVGLLDRESIDLACRAYAVREGLNWCLTRENFKS 802 >gb|PIN13191.1| Cl- channel CLC-3 and related proteins (CLC superfamily) [Handroanthus impetiginosus] Length = 810 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 15 CPVGLLDRESIDLARRAFAVREGLSWFFMQ 104 CPVGLLDRESI+ A RAFA+RE LSWFFMQ Sbjct: 781 CPVGLLDRESINFACRAFAIREDLSWFFMQ 810