BLASTX nr result
ID: Rehmannia31_contig00018324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018324 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45330.1| hypothetical protein MIMGU_mgv1a010654mg [Erythra... 74 6e-13 ref|XP_012843580.1| PREDICTED: triadin [Erythranthe guttata] >gi... 74 6e-13 gb|PIM98873.1| Copper chaperone [Handroanthus impetiginosus] 72 2e-12 ref|XP_020548812.1| heavy metal-associated isoprenylated plant p... 68 4e-11 gb|PNX97049.1| heavy metal transport/detoxification domain-conta... 65 9e-11 gb|KZV50521.1| neurofilament medium polypeptide-like, partial [D... 67 1e-10 gb|PNX61272.1| heavy metal transport/detoxification domain-conta... 65 1e-10 gb|PHU23330.1| hypothetical protein BC332_08437 [Capsicum chinense] 66 3e-10 ref|XP_022141144.1| heavy metal-associated isoprenylated plant p... 63 6e-10 dbj|GAU45163.1| hypothetical protein TSUD_245290 [Trifolium subt... 65 7e-10 gb|PHT53539.1| hypothetical protein CQW23_08001 [Capsicum baccatum] 65 8e-10 ref|XP_016564176.1| PREDICTED: heavy metal-associated isoprenyla... 65 8e-10 gb|PNY14681.1| heavy metal transport/detoxification domain-conta... 65 8e-10 ref|XP_019459127.1| PREDICTED: heavy metal-associated isoprenyla... 65 9e-10 ref|XP_020221788.1| heavy metal-associated isoprenylated plant p... 64 1e-09 ref|XP_020221787.1| heavy metal-associated isoprenylated plant p... 64 2e-09 ref|XP_022984369.1| heavy metal-associated isoprenylated plant p... 64 2e-09 ref|XP_022984370.1| heavy metal-associated isoprenylated plant p... 64 2e-09 ref|XP_023551858.1| heavy metal-associated isoprenylated plant p... 64 2e-09 ref|XP_023551857.1| heavy metal-associated isoprenylated plant p... 64 2e-09 >gb|EYU45330.1| hypothetical protein MIMGU_mgv1a010654mg [Erythranthe guttata] Length = 305 Score = 73.6 bits (179), Expect = 6e-13 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNIM 323 QSMHKMMY++ YQP+Y+IERIPAPQLFSDENPNAC +M Sbjct: 268 QSMHKMMYRHYYQPVYMIERIPAPQLFSDENPNACTVM 305 >ref|XP_012843580.1| PREDICTED: triadin [Erythranthe guttata] gb|EYU45329.1| hypothetical protein MIMGU_mgv1a010654mg [Erythranthe guttata] Length = 306 Score = 73.6 bits (179), Expect = 6e-13 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNIM 323 QSMHKMMY++ YQP+Y+IERIPAPQLFSDENPNAC +M Sbjct: 269 QSMHKMMYRHYYQPVYMIERIPAPQLFSDENPNACTVM 306 >gb|PIM98873.1| Copper chaperone [Handroanthus impetiginosus] Length = 318 Score = 72.4 bits (176), Expect = 2e-12 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +3 Query: 213 SMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNIM 323 SMHKMMY Y YQP Y IERIPAPQLFSDENPNAC IM Sbjct: 282 SMHKMMYHYQYQPPYAIERIPAPQLFSDENPNACTIM 318 >ref|XP_020548812.1| heavy metal-associated isoprenylated plant protein 9 [Sesamum indicum] ref|XP_020548813.1| heavy metal-associated isoprenylated plant protein 9 [Sesamum indicum] Length = 230 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNIM 323 Q MHKMMY +YQP+YVIERIPAPQLFSDENPNAC +M Sbjct: 195 QGMHKMMY--HYQPVYVIERIPAPQLFSDENPNACTLM 230 >gb|PNX97049.1| heavy metal transport/detoxification domain-containing protein [Trifolium pratense] Length = 139 Score = 65.1 bits (157), Expect = 9e-11 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 + M +MMY Y Y PLYVIERIP PQLFSDENPNAC+I Sbjct: 102 EGMKRMMYYYQYPPLYVIERIPPPQLFSDENPNACSI 138 >gb|KZV50521.1| neurofilament medium polypeptide-like, partial [Dorcoceras hygrometricum] Length = 290 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQYNY-QPLYVIERIPAPQLFSDENPNACNIM 323 QSMHK MY YNY QP YVIER+PAPQLFSDENPNAC I+ Sbjct: 252 QSMHKAMYYYNYYQPNYVIERLPAPQLFSDENPNACCIV 290 >gb|PNX61272.1| heavy metal transport/detoxification domain-containing protein, partial [Trifolium pratense] Length = 158 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 + M +MMY Y Y PLYVIERIP PQLFSDENPNAC+I Sbjct: 121 EGMKRMMYYYQYPPLYVIERIPPPQLFSDENPNACSI 157 >gb|PHU23330.1| hypothetical protein BC332_08437 [Capsicum chinense] Length = 303 Score = 66.2 bits (160), Expect = 3e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 213 SMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 S++KMMY Y YQPLYVIERIP PQLFSDENPNAC I Sbjct: 267 SINKMMYYYPYQPLYVIERIPPPQLFSDENPNACCI 302 >ref|XP_022141144.1| heavy metal-associated isoprenylated plant protein 9, partial [Momordica charantia] Length = 132 Score = 62.8 bits (151), Expect = 6e-10 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQY-NYQPLYVIERIPAPQLFSDENPNACNIM 323 ++M +MMY+Y YQPLY+IERIP PQLFSDENPNAC I+ Sbjct: 94 ENMKRMMYRYYQYQPLYIIERIPPPQLFSDENPNACCIL 132 >dbj|GAU45163.1| hypothetical protein TSUD_245290 [Trifolium subterraneum] Length = 285 Score = 65.1 bits (157), Expect = 7e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 + M +MMY Y Y PLYVIERIP PQLFSDENPNAC+I Sbjct: 248 EGMKRMMYYYQYPPLYVIERIPPPQLFSDENPNACSI 284 >gb|PHT53539.1| hypothetical protein CQW23_08001 [Capsicum baccatum] Length = 303 Score = 65.1 bits (157), Expect = 8e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 213 SMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 +++KMMY Y YQPLYVIERIP PQLFSDENPNAC I Sbjct: 267 TINKMMYYYPYQPLYVIERIPPPQLFSDENPNACCI 302 >ref|XP_016564176.1| PREDICTED: heavy metal-associated isoprenylated plant protein 3-like [Capsicum annuum] Length = 303 Score = 65.1 bits (157), Expect = 8e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 213 SMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 +++KMMY Y YQPLYVIERIP PQLFSDENPNAC I Sbjct: 267 TINKMMYYYPYQPLYVIERIPPPQLFSDENPNACCI 302 >gb|PNY14681.1| heavy metal transport/detoxification domain-containing protein [Trifolium pratense] Length = 322 Score = 65.1 bits (157), Expect = 8e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 + M +MMY Y Y PLYVIERIP PQLFSDENPNAC+I Sbjct: 285 EGMKRMMYYYQYPPLYVIERIPPPQLFSDENPNACSI 321 >ref|XP_019459127.1| PREDICTED: heavy metal-associated isoprenylated plant protein 9-like [Lupinus angustifolius] gb|OIW02507.1| hypothetical protein TanjilG_12821 [Lupinus angustifolius] Length = 341 Score = 65.1 bits (157), Expect = 9e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 + M +MMY Y YQPLYVIERIP PQLFSDENPNAC I Sbjct: 304 EGMKRMMYYYPYQPLYVIERIPPPQLFSDENPNACCI 340 >ref|XP_020221788.1| heavy metal-associated isoprenylated plant protein 9-like isoform X2 [Cajanus cajan] Length = 303 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 +SM K+MY +YQPLYVIERIP PQLFSDENPNAC I Sbjct: 266 ESMEKVMYYNHYQPLYVIERIPPPQLFSDENPNACCI 302 >ref|XP_020221787.1| heavy metal-associated isoprenylated plant protein 9-like isoform X1 [Cajanus cajan] Length = 317 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 210 QSMHKMMYQYNYQPLYVIERIPAPQLFSDENPNACNI 320 +SM K+MY +YQPLYVIERIP PQLFSDENPNAC I Sbjct: 280 ESMEKVMYYNHYQPLYVIERIPPPQLFSDENPNACCI 316 >ref|XP_022984369.1| heavy metal-associated isoprenylated plant protein 9 isoform X3 [Cucurbita maxima] Length = 324 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQY-NYQPLYVIERIPAPQLFSDENPNACNIM 323 +SM +MMYQY YQPLYV+ERIP PQLFSDENPNAC ++ Sbjct: 286 ESMKRMMYQYYQYQPLYVMERIPPPQLFSDENPNACCVL 324 >ref|XP_022984370.1| heavy metal-associated isoprenylated plant protein 9 isoform X4 [Cucurbita maxima] Length = 324 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQY-NYQPLYVIERIPAPQLFSDENPNACNIM 323 +SM +MMYQY YQPLYV+ERIP PQLFSDENPNAC ++ Sbjct: 286 ESMKRMMYQYYQYQPLYVMERIPPPQLFSDENPNACCVL 324 >ref|XP_023551858.1| heavy metal-associated isoprenylated plant protein 9 isoform X4 [Cucurbita pepo subsp. pepo] Length = 325 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQY-NYQPLYVIERIPAPQLFSDENPNACNIM 323 +SM +MMYQY YQPLYV+ERIP PQLFSDENPNAC ++ Sbjct: 287 ESMKRMMYQYYQYQPLYVMERIPPPQLFSDENPNACCVL 325 >ref|XP_023551857.1| heavy metal-associated isoprenylated plant protein 9 isoform X3 [Cucurbita pepo subsp. pepo] Length = 325 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 210 QSMHKMMYQY-NYQPLYVIERIPAPQLFSDENPNACNIM 323 +SM +MMYQY YQPLYV+ERIP PQLFSDENPNAC ++ Sbjct: 287 ESMKRMMYQYYQYQPLYVMERIPPPQLFSDENPNACCVL 325