BLASTX nr result
ID: Rehmannia31_contig00018066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018066 (712 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554179.1| LOW QUALITY PROTEIN: dof zinc finger protein... 72 5e-11 gb|PIN07395.1| hypothetical protein CDL12_20042 [Handroanthus im... 62 1e-07 >ref|XP_020554179.1| LOW QUALITY PROTEIN: dof zinc finger protein DOF1.4-like [Sesamum indicum] Length = 350 Score = 72.0 bits (175), Expect = 5e-11 Identities = 40/85 (47%), Positives = 47/85 (55%), Gaps = 19/85 (22%) Frame = +1 Query: 271 QQQKFNQ---------ATNGVLGLMPNYEGTQMPSTGND----------PNTNTNPIDQQ 393 QQQKF A + V GLMP + G + PN N NPI +Q Sbjct: 258 QQQKFGSMGLKDNVQAANSNVPGLMPYEDSHXXXLEGENRLVWNPNHPNPNPNANPIHEQ 317 Query: 394 MNSSDPSSLLWNNTNVGAWFDPSNM 468 +N+SDPSSLLWN TNVGAWFDPSN+ Sbjct: 318 INTSDPSSLLWNTTNVGAWFDPSNI 342 >gb|PIN07395.1| hypothetical protein CDL12_20042 [Handroanthus impetiginosus] gb|PIN08148.1| hypothetical protein CDL12_19283 [Handroanthus impetiginosus] Length = 331 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 12/79 (15%) Frame = +1 Query: 268 FQQQKF--NQATNGVLGLMP----------NYEGTQMPSTGNDPNTNTNPIDQQMNSSDP 411 FQ+QKF N +N GLMP E M S+ +PN N NPI++ +NSSDP Sbjct: 247 FQRQKFANNNNSNNFPGLMPYEDHGKEVKLEGENRLMWSSNPNPNPNPNPIEE-INSSDP 305 Query: 412 SSLLWNNTNVGAWFDPSNM 468 S LW +NVG+WFDPSNM Sbjct: 306 S--LWTTSNVGSWFDPSNM 322