BLASTX nr result
ID: Rehmannia31_contig00017960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017960 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848768.1| PREDICTED: polyadenylate-binding protein RBP... 71 9e-12 >ref|XP_012848768.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X3 [Erythranthe guttata] ref|XP_012848769.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X3 [Erythranthe guttata] Length = 280 Score = 71.2 bits (173), Expect = 9e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 466 NKQKVGGQTKGCQEALSYRGLEPISAEMITLLVPGFV 356 NKQK GGQT GCQEALSYRGL+PISAEMITLLVPGFV Sbjct: 244 NKQKPGGQTTGCQEALSYRGLKPISAEMITLLVPGFV 280