BLASTX nr result
ID: Rehmannia31_contig00017929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017929 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007153701.1| hypothetical protein PHAVU_003G057500g [Phas... 55 4e-06 ref|XP_011096408.1| nudix hydrolase 15, mitochondrial [Sesamum i... 55 6e-06 ref|XP_019251906.1| PREDICTED: nudix hydrolase 15, mitochondrial... 55 8e-06 ref|XP_009771397.1| PREDICTED: nudix hydrolase 15, mitochondrial... 55 8e-06 ref|XP_022638937.1| nudix hydrolase 15, mitochondrial isoform X2... 54 9e-06 gb|KOM31574.1| hypothetical protein LR48_Vigan01g112900 [Vigna a... 54 1e-05 >ref|XP_007153701.1| hypothetical protein PHAVU_003G057500g [Phaseolus vulgaris] gb|ESW25695.1| hypothetical protein PHAVU_003G057500g [Phaseolus vulgaris] Length = 287 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTMP 373 S+VYQRPPAF+EQNPKFK+P V DTTMP Sbjct: 258 SVVYQRPPAFVEQNPKFKVPQNVSNDTTMP 287 >ref|XP_011096408.1| nudix hydrolase 15, mitochondrial [Sesamum indicum] Length = 306 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTMP 373 S+VYQ+PPAFLEQNPKFK+P V K+TTMP Sbjct: 277 SVVYQKPPAFLEQNPKFKVPRVVEKETTMP 306 >ref|XP_019251906.1| PREDICTED: nudix hydrolase 15, mitochondrial-like [Nicotiana attenuata] gb|OIS99216.1| nudix hydrolase 15, mitochondrial [Nicotiana attenuata] Length = 295 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTM 376 S+VYQRPPAFLEQNPKFK+P V KDTTM Sbjct: 266 SVVYQRPPAFLEQNPKFKLPKVVDKDTTM 294 >ref|XP_009771397.1| PREDICTED: nudix hydrolase 15, mitochondrial [Nicotiana sylvestris] ref|XP_016456356.1| PREDICTED: nudix hydrolase 15, mitochondrial-like [Nicotiana tabacum] Length = 307 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTM 376 S+VYQRPPAFLEQNPKFK+P V KDTTM Sbjct: 278 SVVYQRPPAFLEQNPKFKLPKVVDKDTTM 306 >ref|XP_022638937.1| nudix hydrolase 15, mitochondrial isoform X2 [Vigna radiata var. radiata] Length = 248 Score = 54.3 bits (129), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTMP 373 S+VYQRPPAF+EQNPKFK+P V DTT+P Sbjct: 219 SVVYQRPPAFVEQNPKFKVPQNVSNDTTLP 248 >gb|KOM31574.1| hypothetical protein LR48_Vigan01g112900 [Vigna angularis] Length = 262 Score = 54.3 bits (129), Expect = 1e-05 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 462 SIVYQRPPAFLEQNPKFKIPSTVLKDTTMP 373 S+VYQRPPAF+EQNPKFK+P V DTT+P Sbjct: 233 SVVYQRPPAFVEQNPKFKVPQNVSNDTTLP 262