BLASTX nr result
ID: Rehmannia31_contig00017708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017708 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020551769.1| HVA22-like protein k [Sesamum indicum] 54 5e-06 >ref|XP_020551769.1| HVA22-like protein k [Sesamum indicum] Length = 195 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 412 KLYLSANHVVQDIIHPRQRQVNGSAIEGPP 323 K+ LSANH VQDII P QRQVNGSAIEGPP Sbjct: 154 KILLSANHAVQDIIRPGQRQVNGSAIEGPP 183