BLASTX nr result
ID: Rehmannia31_contig00017679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017679 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN06413.1| hypothetical protein CDL12_21033 [Handroanthus im... 73 2e-12 ref|XP_012827338.1| PREDICTED: RING-H2 finger protein ATL22-like... 61 6e-08 ref|XP_011081294.1| RING-H2 finger protein ATL22-like [Sesamum i... 57 1e-06 >gb|PIN06413.1| hypothetical protein CDL12_21033 [Handroanthus impetiginosus] Length = 263 Score = 72.8 bits (177), Expect = 2e-12 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 11/81 (13%) Frame = +3 Query: 3 FGLGLTWNPTGFKEE------RPEKYFK----VSGIIVFVFIGGMVLYAILSNYHKKLNE 152 FGL TWN +G EE +PEKYFK VSGI+V VFI GM+ +A +S Y ++LNE Sbjct: 182 FGLAFTWN-SGLNEESDCETGQPEKYFKTFYGVSGIMVLVFIVGMLFHATISEYREELNE 240 Query: 153 EKV-KATLDEVEIDKLLGEYQ 212 EKV K E EID+LLGEYQ Sbjct: 241 EKVIKDMSREGEIDQLLGEYQ 261 >ref|XP_012827338.1| PREDICTED: RING-H2 finger protein ATL22-like [Erythranthe guttata] gb|EYU19273.1| hypothetical protein MIMGU_mgv1a012065mg [Erythranthe guttata] Length = 262 Score = 60.8 bits (146), Expect = 6e-08 Identities = 38/89 (42%), Positives = 49/89 (55%), Gaps = 19/89 (21%) Frame = +3 Query: 3 FGLGLTWNPTGFK----------------EERP--EKYFKVSGIIVFVFIGGMVLYAILS 128 FGLGLTWN G + E P EK KVS +I +FI GM+ YA S Sbjct: 174 FGLGLTWNSIGLENGEEATSSRCTLGFLCERFPMLEKSLKVSALIASIFIVGMLFYATRS 233 Query: 129 NYHKKLNEEKVKATL-DEVEIDKLLGEYQ 212 Y K++N V+ TL D+ EI++LLGEY+ Sbjct: 234 RYRKEVNARMVQETLGDQFEIEELLGEYK 262 >ref|XP_011081294.1| RING-H2 finger protein ATL22-like [Sesamum indicum] Length = 254 Score = 57.0 bits (136), Expect = 1e-06 Identities = 36/72 (50%), Positives = 41/72 (56%), Gaps = 18/72 (25%) Frame = +3 Query: 3 FGLGLTWNPTGFKEE--------------RPEKYFK----VSGIIVFVFIGGMVLYAILS 128 FGLG TWN +EE R EKYFK VSGII F F+ G++ YA LS Sbjct: 181 FGLGFTWNLV--EEEATSGCMLGILCSTRRLEKYFKDIYTVSGIIAFAFMAGVLFYATLS 238 Query: 129 NYHKKLNEEKVK 164 Y+KKLNEEK K Sbjct: 239 KYYKKLNEEKGK 250