BLASTX nr result
ID: Rehmannia31_contig00017570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017570 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73713.1| hypothetical protein M569_01051, partial [Genlise... 74 5e-15 >gb|EPS73713.1| hypothetical protein M569_01051, partial [Genlisea aurea] Length = 64 Score = 73.6 bits (179), Expect = 5e-15 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +3 Query: 3 IMIIMSWFDDKLRCASNLSRFIAGXXXXXXYHSFQLISNFPIPIQP 140 +MIIMSWFDD LRCA+NLSRFIA YHS QLISNFPIPI P Sbjct: 9 VMIIMSWFDDSLRCANNLSRFIAAILLILSYHSCQLISNFPIPIHP 54