BLASTX nr result
ID: Rehmannia31_contig00017406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017406 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856477.1| PREDICTED: respiratory burst oxidase homolog... 92 9e-20 ref|XP_011073263.1| LOW QUALITY PROTEIN: respiratory burst oxida... 94 3e-19 gb|KZV57929.1| whitefly-induced gp91-phox [Dorcoceras hygrometri... 92 8e-19 ref|XP_012852714.1| PREDICTED: respiratory burst oxidase homolog... 92 8e-19 ref|XP_011082784.1| respiratory burst oxidase homolog protein C ... 91 2e-18 gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] 90 7e-18 ref|XP_022842676.1| respiratory burst oxidase homolog protein C-... 89 9e-18 ref|XP_022842677.1| respiratory burst oxidase homolog protein C-... 89 9e-18 ref|XP_017218624.1| PREDICTED: respiratory burst oxidase homolog... 88 2e-17 ref|XP_017252230.1| PREDICTED: respiratory burst oxidase homolog... 88 3e-17 ref|XP_015898316.1| PREDICTED: respiratory burst oxidase homolog... 85 9e-17 gb|PIN21180.1| Ferric reductase, NADH/NADPH oxidase [Handroanthu... 86 1e-16 ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog... 86 2e-16 ref|XP_015889947.1| PREDICTED: respiratory burst oxidase homolog... 85 4e-16 gb|PIN26491.1| Ferric reductase, NADH/NADPH oxidase [Handroanthu... 84 7e-16 gb|PIN21182.1| Ferric reductase, NADH/NADPH oxidase [Handroanthu... 84 7e-16 ref|XP_021634895.1| respiratory burst oxidase homolog protein C ... 83 2e-15 gb|KHG21481.1| Respiratory burst oxidase D -like protein [Gossyp... 82 3e-15 ref|XP_021285007.1| respiratory burst oxidase homolog protein D-... 82 3e-15 gb|APC57583.1| respiratory burst oxidase D-like protein [Gossypi... 82 3e-15 >ref|XP_012856477.1| PREDICTED: respiratory burst oxidase homolog protein C [Erythranthe guttata] gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Erythranthe guttata] Length = 277 Score = 92.4 bits (228), Expect = 9e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPN+RVGVFYCGAPPPV ELRQLASDFSHKT+T+FEFHKENF Sbjct: 234 LNHPNSRVGVFYCGAPPPVKELRQLASDFSHKTNTKFEFHKENF 277 >ref|XP_011073263.1| LOW QUALITY PROTEIN: respiratory burst oxidase homolog protein C [Sesamum indicum] Length = 918 Score = 93.6 bits (231), Expect = 3e-19 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPNARVGVFYCGAPPPV EL+QLASDFSHKTST+FEFHKENF Sbjct: 875 LNHPNARVGVFYCGAPPPVKELKQLASDFSHKTSTKFEFHKENF 918 >gb|KZV57929.1| whitefly-induced gp91-phox [Dorcoceras hygrometricum] Length = 907 Score = 92.4 bits (228), Expect = 8e-19 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPN+RVGVFYCGAPPPV ELRQLASDFSHKT+T+FEFHKENF Sbjct: 864 LNHPNSRVGVFYCGAPPPVKELRQLASDFSHKTATKFEFHKENF 907 >ref|XP_012852714.1| PREDICTED: respiratory burst oxidase homolog protein C [Erythranthe guttata] gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Erythranthe guttata] Length = 916 Score = 92.4 bits (228), Expect = 8e-19 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 +NHPNARVGVFYCGAPPPV ELRQLASDFSHKT+T+FEFHKENF Sbjct: 873 VNHPNARVGVFYCGAPPPVRELRQLASDFSHKTTTKFEFHKENF 916 >ref|XP_011082784.1| respiratory burst oxidase homolog protein C [Sesamum indicum] Length = 921 Score = 91.3 bits (225), Expect = 2e-18 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPNARVGVFYCGAPPPV EL+QLA DFSHKTST+FEFHKENF Sbjct: 878 LNHPNARVGVFYCGAPPPVKELKQLAYDFSHKTSTKFEFHKENF 921 >gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea] Length = 887 Score = 89.7 bits (221), Expect = 7e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHP RVGVFYCGAPPPV ELRQLASDFSHKTST+F+FHKENF Sbjct: 844 LNHPETRVGVFYCGAPPPVKELRQLASDFSHKTSTKFDFHKENF 887 >ref|XP_022842676.1| respiratory burst oxidase homolog protein C-like isoform X1 [Olea europaea var. sylvestris] Length = 934 Score = 89.4 bits (220), Expect = 9e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPN VGVFYCGAPPPV ELRQLASDFSH+TST+FEFHKENF Sbjct: 891 LNHPNKTVGVFYCGAPPPVKELRQLASDFSHRTSTKFEFHKENF 934 >ref|XP_022842677.1| respiratory burst oxidase homolog protein C-like isoform X2 [Olea europaea var. sylvestris] ref|XP_022842678.1| respiratory burst oxidase homolog protein C-like isoform X3 [Olea europaea var. sylvestris] Length = 934 Score = 89.4 bits (220), Expect = 9e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPN VGVFYCGAPPPV ELRQLASDFSH+TST+FEFHKENF Sbjct: 891 LNHPNKTVGVFYCGAPPPVKELRQLASDFSHRTSTKFEFHKENF 934 >ref|XP_017218624.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Daucus carota subsp. sativus] gb|KZM88550.1| hypothetical protein DCAR_025625 [Daucus carota subsp. sativus] Length = 938 Score = 88.2 bits (217), Expect = 2e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 +NH N+RVGVFYCGAPPPV ELRQLASDFSHKTST+F+FHKENF Sbjct: 895 VNHANSRVGVFYCGAPPPVKELRQLASDFSHKTSTKFDFHKENF 938 >ref|XP_017252230.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Daucus carota subsp. sativus] gb|KZM93080.1| hypothetical protein DCAR_016325 [Daucus carota subsp. sativus] Length = 927 Score = 87.8 bits (216), Expect = 3e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNH N+R+GVFYCGAPPPV ELRQLA+DFSHKTST+F+FHKENF Sbjct: 884 LNHTNSRIGVFYCGAPPPVKELRQLAADFSHKTSTKFDFHKENF 927 >ref|XP_015898316.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Ziziphus jujuba] Length = 294 Score = 84.7 bits (208), Expect = 9e-17 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 L HPNARVGVFYCGAP P+ EL +LASDFSHKTST+FEFHKENF Sbjct: 251 LQHPNARVGVFYCGAPAPIKELGKLASDFSHKTSTKFEFHKENF 294 >gb|PIN21180.1| Ferric reductase, NADH/NADPH oxidase [Handroanthus impetiginosus] Length = 800 Score = 85.9 bits (211), Expect = 1e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHP++RVGVFYCG P PV EL+QLASDFSHKTST+FEFHKENF Sbjct: 757 LNHPDSRVGVFYCGGPKPVEELKQLASDFSHKTSTKFEFHKENF 800 >ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo nucifera] Length = 926 Score = 85.9 bits (211), Expect = 2e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNH NARVGVFYCGAP P ELRQLASDFSHKTST+F+FHKENF Sbjct: 883 LNHQNARVGVFYCGAPAPTKELRQLASDFSHKTSTKFDFHKENF 926 >ref|XP_015889947.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Ziziphus jujuba] Length = 717 Score = 84.7 bits (208), Expect = 4e-16 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 L HPNARVGVFYCGAP P+ EL +LASDFSHKTST+FEFHKENF Sbjct: 674 LQHPNARVGVFYCGAPAPIKELGKLASDFSHKTSTKFEFHKENF 717 >gb|PIN26491.1| Ferric reductase, NADH/NADPH oxidase [Handroanthus impetiginosus] Length = 934 Score = 84.0 bits (206), Expect = 7e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHP++RVGVFYCGAP PV EL+QLAS FSHKTST+FEFHKENF Sbjct: 891 LNHPDSRVGVFYCGAPKPVTELKQLASYFSHKTSTKFEFHKENF 934 >gb|PIN21182.1| Ferric reductase, NADH/NADPH oxidase [Handroanthus impetiginosus] Length = 934 Score = 84.0 bits (206), Expect = 7e-16 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHP++RVGVFYCGAP PV EL+QLAS FSHKTST+FEFHKENF Sbjct: 891 LNHPDSRVGVFYCGAPKPVTELKQLASYFSHKTSTKFEFHKENF 934 >ref|XP_021634895.1| respiratory burst oxidase homolog protein C [Manihot esculenta] gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta] gb|OAY30584.1| hypothetical protein MANES_14G042600 [Manihot esculenta] Length = 908 Score = 82.8 bits (203), Expect = 2e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 LNHPN+RVGVFYCGAP ELRQLASDFSHKT+T+F+FHKENF Sbjct: 865 LNHPNSRVGVFYCGAPALTKELRQLASDFSHKTNTKFDFHKENF 908 >gb|KHG21481.1| Respiratory burst oxidase D -like protein [Gossypium arboreum] Length = 622 Score = 82.0 bits (201), Expect = 3e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 L+HP+AR+GVFYCGAP ELRQLASDFSHKTST+FEFHKENF Sbjct: 579 LHHPDARIGVFYCGAPALTKELRQLASDFSHKTSTKFEFHKENF 622 >ref|XP_021285007.1| respiratory burst oxidase homolog protein D-like [Herrania umbratica] Length = 927 Score = 82.0 bits (201), Expect = 3e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 L+HP+AR+GVFYCGAP ELRQLASDFSHKTST+FEFHKENF Sbjct: 884 LHHPDARIGVFYCGAPALTKELRQLASDFSHKTSTKFEFHKENF 927 >gb|APC57583.1| respiratory burst oxidase D-like protein [Gossypium barbadense] Length = 930 Score = 82.0 bits (201), Expect = 3e-15 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 456 LNHPNARVGVFYCGAPPPVNELRQLASDFSHKTSTRFEFHKENF 325 L+HP+AR+GVFYCGAP ELRQLASDFSHKTST+FEFHKENF Sbjct: 887 LHHPDARIGVFYCGAPALTKELRQLASDFSHKTSTKFEFHKENF 930