BLASTX nr result
ID: Rehmannia31_contig00017063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00017063 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN05574.1| hypothetical protein CDL12_21885 [Handroanthus im... 59 2e-07 ref|XP_022844954.1| cyclic dof factor 1-like [Olea europaea var.... 59 2e-07 emb|CDP12294.1| unnamed protein product [Coffea canephora] 57 8e-07 ref|XP_011071702.1| cyclic dof factor 3-like [Sesamum indicum] 56 2e-06 ref|XP_011087240.1| cyclic dof factor 1 [Sesamum indicum] 56 2e-06 ref|XP_016505291.1| PREDICTED: cyclic dof factor 3-like [Nicotia... 55 5e-06 ref|XP_009587736.1| PREDICTED: cyclic dof factor 3 [Nicotiana to... 55 5e-06 ref|XP_019258034.1| PREDICTED: cyclic dof factor 3 [Nicotiana at... 55 5e-06 >gb|PIN05574.1| hypothetical protein CDL12_21885 [Handroanthus impetiginosus] Length = 484 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPKG EKK V+ SPLLQANPAALSRS+SF E A Sbjct: 446 LFKALQPKGDEKKQTVSTSPLLQANPAALSRSISFHETA 484 >ref|XP_022844954.1| cyclic dof factor 1-like [Olea europaea var. sylvestris] Length = 502 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPKG EKKS+V+ SP+LQANPAA SRS+SF+E A Sbjct: 464 LFKALQPKGDEKKSLVSPSPVLQANPAAFSRSISFQETA 502 >emb|CDP12294.1| unnamed protein product [Coffea canephora] Length = 501 Score = 57.0 bits (136), Expect = 8e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPKG EKK + T SP+LQANPAALSRS++F+E A Sbjct: 463 LFKALQPKGDEKKHLTTASPVLQANPAALSRSVTFQESA 501 >ref|XP_011071702.1| cyclic dof factor 3-like [Sesamum indicum] Length = 496 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPKG EKK V S LLQANPAALSRS+SF+E A Sbjct: 458 LFKALQPKGDEKKQKVNTSALLQANPAALSRSISFQESA 496 >ref|XP_011087240.1| cyclic dof factor 1 [Sesamum indicum] Length = 497 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPKG EKK V+ SP+LQANPAALSRS++F+E A Sbjct: 459 LFKALQPKGDEKKQAVSASPVLQANPAALSRSINFQEGA 497 >ref|XP_016505291.1| PREDICTED: cyclic dof factor 3-like [Nicotiana tabacum] Length = 499 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPK +K T SP+LQANPAALSRS+SF+ERA Sbjct: 461 LFKALQPKSDKKDHTATTSPMLQANPAALSRSLSFQERA 499 >ref|XP_009587736.1| PREDICTED: cyclic dof factor 3 [Nicotiana tomentosiformis] Length = 503 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPK +K T SP+LQANPAALSRS+SF+ERA Sbjct: 465 LFKALQPKSDKKDHTATTSPMLQANPAALSRSLSFQERA 503 >ref|XP_019258034.1| PREDICTED: cyclic dof factor 3 [Nicotiana attenuata] gb|OIT40778.1| cyclic dof factor 3 [Nicotiana attenuata] Length = 508 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 LLKALQPKGYEKKSMVTNSPLLQANPAALSRSMSFRERA 119 L KALQPK +K T SP+LQANPAALSRS+SF+ERA Sbjct: 470 LFKALQPKSDKKDHSATTSPMLQANPAALSRSLSFQERA 508