BLASTX nr result
ID: Rehmannia31_contig00016880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016880 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097058.1| UDP-glucuronate:xylan alpha-glucuronosyltran... 52 2e-08 ref|XP_020554375.1| UDP-glucuronate:xylan alpha-glucuronosyltran... 52 2e-08 >ref|XP_011097058.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 isoform X1 [Sesamum indicum] ref|XP_011097059.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 isoform X1 [Sesamum indicum] ref|XP_011097060.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 isoform X1 [Sesamum indicum] Length = 627 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 392 KESYRGSK*KSVENPFKLVIAGKNSRCKFHPLKFV 288 K + K + VENPFKLVIAGK+SRCKFHPLK V Sbjct: 12 KRKLQKIKVRGVENPFKLVIAGKSSRCKFHPLKLV 46 Score = 34.7 bits (78), Expect(2) = 2e-08 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 292 LFLVIIVVATFLTILSSRTVCQQNSM 215 L LVIIV+ +FL I SS TVC QNS+ Sbjct: 45 LVLVIIVLGSFLMIFSSPTVCHQNSI 70 >ref|XP_020554375.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 isoform X2 [Sesamum indicum] Length = 621 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 392 KESYRGSK*KSVENPFKLVIAGKNSRCKFHPLKFV 288 K + K + VENPFKLVIAGK+SRCKFHPLK V Sbjct: 12 KRKLQKIKVRGVENPFKLVIAGKSSRCKFHPLKLV 46 Score = 34.7 bits (78), Expect(2) = 2e-08 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 292 LFLVIIVVATFLTILSSRTVCQQNSM 215 L LVIIV+ +FL I SS TVC QNS+ Sbjct: 45 LVLVIIVLGSFLMIFSSPTVCHQNSI 70