BLASTX nr result
ID: Rehmannia31_contig00016573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016573 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070023.1| LRR receptor kinase BAK1 [Sesamum indicum] 60 3e-08 ref|XP_012839562.1| PREDICTED: somatic embryogenesis receptor ki... 57 3e-07 ref|XP_022899627.1| leucine-rich repeat protein 1-like [Olea eur... 54 4e-06 >ref|XP_011070023.1| LRR receptor kinase BAK1 [Sesamum indicum] Length = 217 Score = 59.7 bits (143), Expect = 3e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 115 MAGRALLVFLALTILSSSVLLPKARGNSEGDALNALRR 2 MAGR LVFLALT++SSS++LPKA GNSEGDAL ALRR Sbjct: 1 MAGRDFLVFLALTVVSSSLVLPKASGNSEGDALYALRR 38 >ref|XP_012839562.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Erythranthe guttata] gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Erythranthe guttata] Length = 217 Score = 57.0 bits (136), Expect = 3e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 115 MAGRALLVFLALTILSSSVLLPKARGNSEGDALNALRR 2 MAGR LL+FLALTI+SSS+L+ KA GNSEGDAL ALRR Sbjct: 1 MAGRDLLLFLALTIVSSSLLVQKALGNSEGDALYALRR 38 >ref|XP_022899627.1| leucine-rich repeat protein 1-like [Olea europaea var. sylvestris] Length = 217 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 115 MAGRALLVFLALTILSSSVLLPKARGNSEGDALNALRR 2 MAGR LL+F+A+T++SSS++ P ARGNS+GDAL LRR Sbjct: 1 MAGRDLLLFVAVTVISSSLMAPMARGNSDGDALYVLRR 38