BLASTX nr result
ID: Rehmannia31_contig00016475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016475 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus im... 65 5e-11 gb|EYU37911.1| hypothetical protein MIMGU_mgv1a017615mg [Erythra... 64 7e-11 ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamu... 63 3e-10 gb|OMO74418.1| hypothetical protein CCACVL1_16743 [Corchorus cap... 59 6e-09 ref|XP_014524310.1| uncharacterized protein LOC106780522 [Vigna ... 59 9e-09 ref|XP_007042000.1| PREDICTED: uncharacterized protein LOC186076... 59 9e-09 ref|XP_022136306.1| uncharacterized protein LOC111008022 [Momord... 59 1e-08 ref|XP_015892295.1| PREDICTED: uncharacterized protein LOC107426... 59 1e-08 ref|XP_022725264.1| uncharacterized protein LOC111281821 [Durio ... 58 2e-08 ref|NP_001304332.1| protein Aucsia-2 [Solanum lycopersicum] >gi|... 58 2e-08 ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea e... 58 2e-08 ref|XP_021889253.1| uncharacterized protein LOC110808171 [Carica... 58 2e-08 ref|XP_021692694.1| uncharacterized protein LOC110673801 [Hevea ... 58 2e-08 ref|XP_021285646.1| uncharacterized protein LOC110417563 [Herran... 58 2e-08 ref|XP_020094617.1| uncharacterized protein LOC109714415 [Ananas... 57 3e-08 gb|PHT59039.1| hypothetical protein CQW23_01402 [Capsicum baccat... 57 3e-08 ref|XP_021640493.1| uncharacterized protein LOC110635463 [Hevea ... 57 3e-08 gb|OIW05659.1| hypothetical protein TanjilG_23445 [Lupinus angus... 57 3e-08 ref|XP_012073836.1| uncharacterized protein LOC105635370 isoform... 57 3e-08 ref|XP_006423528.1| uncharacterized protein LOC18034539 [Citrus ... 57 3e-08 >gb|PIM99838.1| hypothetical protein CDL12_27663 [Handroanthus impetiginosus] Length = 53 Score = 64.7 bits (156), Expect = 5e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGSVKLK LKAQAKSHKKAEAKGHH Sbjct: 22 AFSFGLVYGSVKLKILKAQAKSHKKAEAKGHH 53 >gb|EYU37911.1| hypothetical protein MIMGU_mgv1a017615mg [Erythranthe guttata] Length = 53 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFGIVYGSVKL+ LKAQAKSHKKAEAKGHH Sbjct: 22 AFSFGIVYGSVKLRILKAQAKSHKKAEAKGHH 53 >ref|XP_011088539.1| uncharacterized protein LOC105169741 [Sesamum indicum] Length = 53 Score = 62.8 bits (151), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGSVKLK LK QAKSHKKAEAKGHH Sbjct: 22 AFSFGLVYGSVKLKILKMQAKSHKKAEAKGHH 53 >gb|OMO74418.1| hypothetical protein CCACVL1_16743 [Corchorus capsularis] gb|OMP03118.1| ATPase, F0 complex, subunit E, mitochondrial [Corchorus olitorius] Length = 53 Score = 59.3 bits (142), Expect = 6e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFGIVYGS+KLK+LKA+AKS KKAEAK HH Sbjct: 22 AFSFGIVYGSIKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_014524310.1| uncharacterized protein LOC106780522 [Vigna radiata var. radiata] ref|XP_017432364.1| PREDICTED: uncharacterized protein LOC108339688 [Vigna angularis] Length = 53 Score = 58.9 bits (141), Expect = 9e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLK+LKA+AKSHKKA+ K HH Sbjct: 22 AFSFGVVYGSIKLKYLKAKAKSHKKAQEKAHH 53 >ref|XP_007042000.1| PREDICTED: uncharacterized protein LOC18607671 [Theobroma cacao] gb|EOX97831.1| Uncharacterized protein TCM_006763 [Theobroma cacao] Length = 53 Score = 58.9 bits (141), Expect = 9e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLKFLKA+AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSMKLKFLKAKAKSQKKAEAKAHH 53 >ref|XP_022136306.1| uncharacterized protein LOC111008022 [Momordica charantia] Length = 53 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS KLK+L+A+AKSHKKAEAK HH Sbjct: 22 AFSFGLVYGSFKLKYLQAKAKSHKKAEAKAHH 53 >ref|XP_015892295.1| PREDICTED: uncharacterized protein LOC107426588 [Ziziphus jujuba] Length = 53 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLK+LKA+AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSIKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_022725264.1| uncharacterized protein LOC111281821 [Durio zibethinus] Length = 53 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGSVKLK+LKA AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSVKLKYLKATAKSQKKAEAKSHH 53 >ref|NP_001304332.1| protein Aucsia-2 [Solanum lycopersicum] ref|XP_006359613.1| PREDICTED: uncharacterized protein LOC102599862 [Solanum tuberosum] Length = 53 Score = 58.2 bits (139), Expect = 2e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AF+FG+VYGS+KLK+LKA+AKSH+KAEAK HH Sbjct: 22 AFTFGLVYGSMKLKYLKAKAKSHQKAEAKAHH 53 >ref|XP_022876197.1| uncharacterized protein LOC111394562 [Olea europaea var. sylvestris] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYG++KLK LKA+AKSHKKAEAK HH Sbjct: 22 AFSFGLVYGNMKLKILKAKAKSHKKAEAKTHH 53 >ref|XP_021889253.1| uncharacterized protein LOC110808171 [Carica papaya] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLK+LKA+AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSMKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_021692694.1| uncharacterized protein LOC110673801 [Hevea brasiliensis] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGSVKLK LK +AKSHKK+EAK HH Sbjct: 22 AFSFGLVYGSVKLKILKMKAKSHKKSEAKAHH 53 >ref|XP_021285646.1| uncharacterized protein LOC110417563 [Herrania umbratica] Length = 53 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLK+LKA+AKS KKAEAK HH Sbjct: 22 AFSFGLVYGSMKLKYLKAKAKSQKKAEAKAHH 53 >ref|XP_020094617.1| uncharacterized protein LOC109714415 [Ananas comosus] Length = 52 Score = 57.4 bits (137), Expect = 3e-08 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AF+FG+VYGS+KL +L+++AKSH+KAEAKGHH Sbjct: 21 AFTFGVVYGSIKLSYLRSKAKSHQKAEAKGHH 52 >gb|PHT59039.1| hypothetical protein CQW23_01402 [Capsicum baccatum] gb|PHU10650.1| hypothetical protein BC332_22510 [Capsicum chinense] Length = 53 Score = 57.4 bits (137), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AF+FG+VYGS+KLK+LK +AKSH+KAEAK HH Sbjct: 22 AFTFGLVYGSIKLKYLKVKAKSHQKAEAKAHH 53 >ref|XP_021640493.1| uncharacterized protein LOC110635463 [Hevea brasiliensis] Length = 53 Score = 57.4 bits (137), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFS G+VYG++KLK+LKA+AKSHKKAEAK HH Sbjct: 22 AFSLGLVYGNLKLKYLKAKAKSHKKAEAKAHH 53 >gb|OIW05659.1| hypothetical protein TanjilG_23445 [Lupinus angustifolius] Length = 53 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGS+KLK LKA+AKSH KAEAK HH Sbjct: 22 AFSFGLVYGSLKLKVLKAKAKSHNKAEAKAHH 53 >ref|XP_012073836.1| uncharacterized protein LOC105635370 isoform X1 [Jatropha curcas] Length = 53 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYGSVKLK LK +AKSHKK+EAK HH Sbjct: 22 AFSFGLVYGSVKLKVLKMKAKSHKKSEAKAHH 53 >ref|XP_006423528.1| uncharacterized protein LOC18034539 [Citrus clementina] ref|XP_006487285.1| PREDICTED: uncharacterized protein LOC102627696 [Citrus sinensis] gb|ESR36768.1| hypothetical protein CICLE_v10029771mg [Citrus clementina] gb|KDO46690.1| hypothetical protein CISIN_1g035398mg [Citrus sinensis] Length = 53 Score = 57.4 bits (137), Expect = 3e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 511 AFSFGIVYGSVKLKFLKAQAKSHKKAEAKGHH 416 AFSFG+VYG++KLK+LK++AKS KKAEAKGHH Sbjct: 22 AFSFGLVYGNIKLKYLKSKAKSLKKAEAKGHH 53