BLASTX nr result
ID: Rehmannia31_contig00016439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016439 (706 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853977.1| PREDICTED: transcription factor BIM1 isoform... 75 7e-12 ref|XP_012853976.1| PREDICTED: transcription factor BIM1 isoform... 75 7e-12 ref|XP_011078688.1| transcription factor BIM1 isoform X2 [Sesamu... 65 2e-08 ref|XP_011078682.1| transcription factor BIM1 isoform X1 [Sesamu... 65 2e-08 ref|XP_016488747.1| PREDICTED: transcription factor BIM1-like is... 60 9e-07 ref|XP_016488746.1| PREDICTED: transcription factor BIM1-like is... 60 9e-07 ref|XP_009611733.1| PREDICTED: transcription factor BIM1 isoform... 60 9e-07 ref|XP_018629327.1| PREDICTED: transcription factor BIM1 isoform... 60 9e-07 ref|XP_018629326.1| PREDICTED: transcription factor BIM1 isoform... 60 9e-07 ref|XP_018629324.1| PREDICTED: transcription factor BIM1 isoform... 60 9e-07 gb|ONI08977.1| hypothetical protein PRUPE_5G210500 [Prunus persi... 60 1e-06 ref|XP_021809967.1| transcription factor BIM1 isoform X4 [Prunus... 60 1e-06 ref|XP_020420000.1| transcription factor BIM1 isoform X2 [Prunus... 60 1e-06 ref|XP_020420002.1| transcription factor BIM1 isoform X3 [Prunus... 60 1e-06 ref|XP_021809962.1| transcription factor BIM1 isoform X1 [Prunus... 60 1e-06 ref|XP_020419999.1| transcription factor BIM1 isoform X1 [Prunus... 60 1e-06 ref|XP_008240069.1| PREDICTED: transcription factor BIM1 isoform... 60 1e-06 ref|XP_008240068.1| PREDICTED: transcription factor BIM1 isoform... 60 1e-06 ref|XP_009337847.1| PREDICTED: transcription factor BIM1 isoform... 59 3e-06 ref|XP_008393259.1| PREDICTED: transcription factor BIM1 isoform... 59 3e-06 >ref|XP_012853977.1| PREDICTED: transcription factor BIM1 isoform X2 [Erythranthe guttata] gb|EYU23637.1| hypothetical protein MIMGU_mgv1a004008mg [Erythranthe guttata] Length = 541 Score = 75.1 bits (183), Expect = 7e-12 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSS-PPAHAQQDPITPQ 705 MELPQPRP+GT+GRKATHDFLSLYSS PPAHAQQDP PQ Sbjct: 1 MELPQPRPIGTEGRKATHDFLSLYSSTPPAHAQQDPAPPQ 40 >ref|XP_012853976.1| PREDICTED: transcription factor BIM1 isoform X1 [Erythranthe guttata] gb|EYU23636.1| hypothetical protein MIMGU_mgv1a004008mg [Erythranthe guttata] Length = 549 Score = 75.1 bits (183), Expect = 7e-12 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSS-PPAHAQQDPITPQ 705 MELPQPRP+GT+GRKATHDFLSLYSS PPAHAQQDP PQ Sbjct: 1 MELPQPRPIGTEGRKATHDFLSLYSSTPPAHAQQDPAPPQ 40 >ref|XP_011078688.1| transcription factor BIM1 isoform X2 [Sesamum indicum] Length = 554 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQ RPLGT+GRKATHDFLSLYSSPP AQQDP Q Sbjct: 1 MELPQSRPLGTEGRKATHDFLSLYSSPP--AQQDPTPSQ 37 >ref|XP_011078682.1| transcription factor BIM1 isoform X1 [Sesamum indicum] Length = 555 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQ RPLGT+GRKATHDFLSLYSSPP AQQDP Q Sbjct: 1 MELPQSRPLGTEGRKATHDFLSLYSSPP--AQQDPTPSQ 37 >ref|XP_016488747.1| PREDICTED: transcription factor BIM1-like isoform X2 [Nicotiana tabacum] Length = 556 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >ref|XP_016488746.1| PREDICTED: transcription factor BIM1-like isoform X1 [Nicotiana tabacum] Length = 558 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >ref|XP_009611733.1| PREDICTED: transcription factor BIM1 isoform X4 [Nicotiana tomentosiformis] Length = 558 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >ref|XP_018629327.1| PREDICTED: transcription factor BIM1 isoform X3 [Nicotiana tomentosiformis] Length = 562 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >ref|XP_018629326.1| PREDICTED: transcription factor BIM1 isoform X2 [Nicotiana tomentosiformis] Length = 563 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >ref|XP_018629324.1| PREDICTED: transcription factor BIM1 isoform X1 [Nicotiana tomentosiformis] ref|XP_018629325.1| PREDICTED: transcription factor BIM1 isoform X1 [Nicotiana tomentosiformis] Length = 564 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITPQ 705 MELPQPRP GT+GRK THDFLSLYS QQDPI PQ Sbjct: 1 MELPQPRPFGTEGRKTTHDFLSLYSP----VQQDPIPPQ 35 >gb|ONI08977.1| hypothetical protein PRUPE_5G210500 [Prunus persica] gb|ONI08978.1| hypothetical protein PRUPE_5G210500 [Prunus persica] Length = 574 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_021809967.1| transcription factor BIM1 isoform X4 [Prunus avium] ref|XP_021809968.1| transcription factor BIM1 isoform X4 [Prunus avium] Length = 575 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_020420000.1| transcription factor BIM1 isoform X2 [Prunus persica] ref|XP_020420001.1| transcription factor BIM1 isoform X2 [Prunus persica] gb|ONI08980.1| hypothetical protein PRUPE_5G210500 [Prunus persica] gb|ONI08981.1| hypothetical protein PRUPE_5G210500 [Prunus persica] Length = 575 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_020420002.1| transcription factor BIM1 isoform X3 [Prunus persica] gb|ONI08979.1| hypothetical protein PRUPE_5G210500 [Prunus persica] Length = 575 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_021809962.1| transcription factor BIM1 isoform X1 [Prunus avium] ref|XP_021809963.1| transcription factor BIM1 isoform X1 [Prunus avium] ref|XP_021809964.1| transcription factor BIM1 isoform X1 [Prunus avium] ref|XP_021809965.1| transcription factor BIM1 isoform X2 [Prunus avium] ref|XP_021809966.1| transcription factor BIM1 isoform X3 [Prunus avium] Length = 576 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_020419999.1| transcription factor BIM1 isoform X1 [Prunus persica] gb|ONI08982.1| hypothetical protein PRUPE_5G210500 [Prunus persica] Length = 576 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_008240069.1| PREDICTED: transcription factor BIM1 isoform X2 [Prunus mume] Length = 576 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_008240068.1| PREDICTED: transcription factor BIM1 isoform X1 [Prunus mume] ref|XP_016651277.1| PREDICTED: transcription factor BIM1 isoform X1 [Prunus mume] Length = 577 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK THDFLSLYS P AQQDP P Sbjct: 1 MELPQPRPFGTEGRKPTHDFLSLYSHPT--AQQDPRPP 36 >ref|XP_009337847.1| PREDICTED: transcription factor BIM1 isoform X1 [Pyrus x bretschneideri] ref|XP_009337855.1| PREDICTED: transcription factor BIM1 isoform X1 [Pyrus x bretschneideri] Length = 572 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK+THDFLSLYS + AQQDP +P Sbjct: 1 MELPQPRPFGTEGRKSTHDFLSLYSH--SAAQQDPRSP 36 >ref|XP_008393259.1| PREDICTED: transcription factor BIM1 isoform X1 [Malus domestica] ref|XP_017178043.1| PREDICTED: transcription factor BIM1 isoform X1 [Malus domestica] Length = 572 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 589 MELPQPRPLGTQGRKATHDFLSLYSSPPAHAQQDPITP 702 MELPQPRP GT+GRK+THDFLSLYS + AQQDP +P Sbjct: 1 MELPQPRPFGTEGRKSTHDFLSLYSH--SAAQQDPRSP 36