BLASTX nr result
ID: Rehmannia31_contig00016167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016167 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017191990.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 1e-10 gb|PHU09282.1| Chlorophyll(ide) b reductase NOL, chloroplastic, ... 65 2e-10 dbj|BAO56869.1| chlorophyll b reductase, partial [Egeria densa] 65 3e-10 gb|PKI76558.1| hypothetical protein CRG98_003017 [Punica granatum] 65 6e-10 ref|XP_015870484.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 6e-10 gb|PIN19138.1| Chlorophyll(ide) b reductase [Handroanthus impeti... 65 6e-10 gb|PIN02249.1| Chlorophyll(ide) b reductase [Handroanthus impeti... 65 8e-10 ref|XP_015869181.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 9e-10 gb|EPS61191.1| hypothetical protein M569_13608, partial [Genlise... 65 9e-10 gb|AEO19897.1| chlorophyll(ide) b reductase, partial [Pyrus x br... 65 9e-10 gb|PHT40698.1| hypothetical protein CQW23_19552, partial [Capsic... 65 1e-09 ref|XP_008354868.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 2e-09 ref|XP_009796256.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 2e-09 ref|XP_008456630.1| PREDICTED: chlorophyll(ide) b reductase NOL,... 65 2e-09 ref|XP_015936969.1| chlorophyll(ide) b reductase NOL, chloroplas... 65 2e-09 ref|XP_020985251.1| chlorophyll(ide) b reductase NOL, chloroplas... 65 2e-09 ref|XP_016170916.1| chlorophyll(ide) b reductase NOL, chloroplas... 65 3e-09 ref|XP_016170915.1| chlorophyll(ide) b reductase NOL, chloroplas... 65 3e-09 gb|ESR58923.1| hypothetical protein CICLE_v10016279mg [Citrus cl... 65 3e-09 dbj|GAU30414.1| hypothetical protein TSUD_364600 [Trifolium subt... 65 3e-09 >ref|XP_017191990.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic, partial [Malus domestica] Length = 92 Score = 65.5 bits (158), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 42 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 72 >gb|PHU09282.1| Chlorophyll(ide) b reductase NOL, chloroplastic, partial [Capsicum chinense] Length = 102 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 72 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 102 >dbj|BAO56869.1| chlorophyll b reductase, partial [Egeria densa] Length = 126 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 59 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 89 >gb|PKI76558.1| hypothetical protein CRG98_003017 [Punica granatum] Length = 154 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 25 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 55 >ref|XP_015870484.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Ziziphus jujuba] Length = 154 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 25 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 55 >gb|PIN19138.1| Chlorophyll(ide) b reductase [Handroanthus impetiginosus] Length = 157 Score = 65.5 bits (158), Expect = 6e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 25 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 55 >gb|PIN02249.1| Chlorophyll(ide) b reductase [Handroanthus impetiginosus] Length = 173 Score = 65.5 bits (158), Expect = 8e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 44 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 74 >ref|XP_015869181.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic, partial [Ziziphus jujuba] Length = 176 Score = 65.5 bits (158), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 47 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 77 >gb|EPS61191.1| hypothetical protein M569_13608, partial [Genlisea aurea] Length = 177 Score = 65.5 bits (158), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 131 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 161 >gb|AEO19897.1| chlorophyll(ide) b reductase, partial [Pyrus x bretschneideri] Length = 178 Score = 65.5 bits (158), Expect = 9e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 54 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 84 >gb|PHT40698.1| hypothetical protein CQW23_19552, partial [Capsicum baccatum] Length = 198 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 168 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 198 >ref|XP_008354868.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Malus domestica] Length = 221 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 165 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 195 >ref|XP_009796256.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform X3 [Nicotiana sylvestris] Length = 224 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 95 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 125 >ref|XP_008456630.1| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic isoform X3 [Cucumis melo] Length = 224 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 95 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 125 >ref|XP_015936969.1| chlorophyll(ide) b reductase NOL, chloroplastic isoform X7 [Arachis duranensis] Length = 247 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 118 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 148 >ref|XP_020985251.1| chlorophyll(ide) b reductase NOL, chloroplastic isoform X6 [Arachis duranensis] Length = 248 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 119 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 149 >ref|XP_016170916.1| chlorophyll(ide) b reductase NOL, chloroplastic isoform X7 [Arachis ipaensis] Length = 251 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 122 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 152 >ref|XP_016170915.1| chlorophyll(ide) b reductase NOL, chloroplastic isoform X6 [Arachis ipaensis] Length = 252 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 123 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 153 >gb|ESR58923.1| hypothetical protein CICLE_v10016279mg [Citrus clementina] Length = 265 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 136 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 166 >dbj|GAU30414.1| hypothetical protein TSUD_364600 [Trifolium subterraneum] Length = 267 Score = 65.5 bits (158), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 94 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA Sbjct: 145 GAGSDGRPTPRFAAYGATKRSVVHLTKSLQA 175