BLASTX nr result
ID: Rehmannia31_contig00016120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00016120 (651 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containi... 48 3e-08 gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythra... 48 3e-08 gb|PIM99127.1| hypothetical protein CDL12_28382 [Handroanthus im... 46 1e-07 >ref|XP_012839049.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Erythranthe guttata] Length = 760 Score = 47.8 bits (112), Expect(2) = 3e-08 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -1 Query: 126 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAML 1 DGEVE MKA AA DESEDGAE+ +VS AL DKVDAML Sbjct: 632 DGEVEAMKAYK-AAHDESEDGAEVPERHVVSSALIDKVDAML 672 Score = 38.5 bits (88), Expect(2) = 3e-08 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 205 REHKEFIWLDNEEIELFNRMVDKDGT 128 RE +EF+ L N+EI+L+N MVDKDGT Sbjct: 606 REREEFLRLVNKEIKLYNSMVDKDGT 631 >gb|EYU36668.1| hypothetical protein MIMGU_mgv1a001786mg [Erythranthe guttata] Length = 759 Score = 47.8 bits (112), Expect(2) = 3e-08 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -1 Query: 126 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAML 1 DGEVE MKA AA DESEDGAE+ +VS AL DKVDAML Sbjct: 631 DGEVEAMKAYK-AAHDESEDGAEVPERHVVSSALIDKVDAML 671 Score = 38.5 bits (88), Expect(2) = 3e-08 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 205 REHKEFIWLDNEEIELFNRMVDKDGT 128 RE +EF+ L N+EI+L+N MVDKDGT Sbjct: 605 REREEFLRLVNKEIKLYNSMVDKDGT 630 >gb|PIM99127.1| hypothetical protein CDL12_28382 [Handroanthus impetiginosus] Length = 577 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -1 Query: 126 DGEVEPMKACV*AARDESEDGAEIFVYIMVSFALTDKVDAML 1 DGEVE MKA AA D+SEDGAE+ M+S AL DKVD+ML Sbjct: 448 DGEVEAMKAYK-AASDDSEDGAEVPRRDMISSALIDKVDSML 488 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 205 REHKEFIWLDNEEIELFNRMVDKDG 131 RE +EF+ L N+EIEL+N MVDKDG Sbjct: 422 REREEFLRLVNKEIELYNSMVDKDG 446