BLASTX nr result
ID: Rehmannia31_contig00015592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00015592 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus im... 82 6e-18 gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus im... 75 3e-15 ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798... 51 5e-06 >gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus impetiginosus] Length = 43 Score = 82.0 bits (201), Expect = 6e-18 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 277 MHSVPSSDLLLLTRPHVTFFYGGSSFHRLKHLHKSDRRGNLSS 149 MHSVPS+DLLLLTR HVT FYGGSSFHRLKHL KSDRRGNLSS Sbjct: 1 MHSVPSNDLLLLTRQHVTSFYGGSSFHRLKHLQKSDRRGNLSS 43 >gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus impetiginosus] gb|PIN15072.1| hypothetical protein CDL12_12303 [Handroanthus impetiginosus] Length = 43 Score = 75.1 bits (183), Expect = 3e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 277 MHSVPSSDLLLLTRPHVTFFYGGSSFHRLKHLHKSDRRGNLSS 149 MHSVPS DL++ TRPH+T FYGGSS HRLKHL KSDRRGN+SS Sbjct: 1 MHSVPSYDLVVFTRPHLTSFYGGSSSHRLKHLQKSDRRGNISS 43 >ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798098 [Glycine max] Length = 39 Score = 51.2 bits (121), Expect = 5e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 268 VPSSDLLLLTRPHVTFFYGGSSFHRLKHLHKSDRRGNLS 152 +PS + L P +T F+GGSSFHRLK+L KSDRRGNLS Sbjct: 1 MPSVPVDLRLVPSLTVFHGGSSFHRLKNLEKSDRRGNLS 39