BLASTX nr result
ID: Rehmannia31_contig00014919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014919 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077644.1| oxysterol-binding protein-related protein 3A... 56 2e-06 ref|XP_018836058.1| PREDICTED: oxysterol-binding protein-related... 54 1e-05 >ref|XP_011077644.1| oxysterol-binding protein-related protein 3A-like [Sesamum indicum] Length = 459 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 387 HRTAVDSSDSIGETETSSLEFNPWQYNNLSDAQS 286 HR AVD+SDSI ETET+S+EFNPW+Y+NL +AQ+ Sbjct: 426 HREAVDNSDSIRETETNSIEFNPWKYHNLPNAQT 459 >ref|XP_018836058.1| PREDICTED: oxysterol-binding protein-related protein 3C [Juglans regia] Length = 456 Score = 53.9 bits (128), Expect = 1e-05 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 390 QHRTAVDSSDSIGETETSSLEFNPWQYNNLSD 295 QHR AVDSSDS+ E + S+EFNPWQY NLS+ Sbjct: 424 QHRAAVDSSDSVNEVDVRSIEFNPWQYGNLSE 455