BLASTX nr result
ID: Rehmannia31_contig00014918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014918 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077644.1| oxysterol-binding protein-related protein 3A... 60 5e-08 >ref|XP_011077644.1| oxysterol-binding protein-related protein 3A-like [Sesamum indicum] Length = 459 Score = 60.5 bits (145), Expect = 5e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 375 HRTAVDSSDSIGETETSSLEFNPWQYHNLSDAQT 274 HR AVD+SDSI ETET+S+EFNPW+YHNL +AQT Sbjct: 426 HREAVDNSDSIRETETNSIEFNPWKYHNLPNAQT 459