BLASTX nr result
ID: Rehmannia31_contig00014780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014780 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 60 3e-09 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 60.1 bits (144), Expect = 3e-09 Identities = 27/63 (42%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Frame = +2 Query: 59 ILWRAIVHVECWSVWLERNNRIFYESEETSLECWD-----ISSWVKGDNEFKHLFVSDLT 223 +LW+ + W +WLERN RIF EE S+ WD I+ W+ + EF L SDL Sbjct: 29 VLWKVAMMAIWWRIWLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSDLV 88 Query: 224 RDW 232 RDW Sbjct: 89 RDW 91