BLASTX nr result
ID: Rehmannia31_contig00014756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014756 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11684.1| hypothetical protein CDL12_15714 [Handroanthus im... 73 1e-12 ref|XP_011078285.1| ninja-family protein mc410 [Sesamum indicum]... 67 1e-10 ref|XP_015076615.1| PREDICTED: ninja-family protein mc410 [Solan... 67 2e-10 ref|XP_006338155.1| PREDICTED: ninja-family protein mc410 [Solan... 67 2e-10 ref|XP_004239269.1| PREDICTED: ninja-family protein mc410 [Solan... 67 2e-10 gb|PHU15384.1| Ninja-family protein [Capsicum chinense] 67 2e-10 gb|PHT46263.1| Ninja-family protein [Capsicum baccatum] 67 2e-10 gb|KZV15514.1| ninja-family protein mc410-like [Dorcoceras hygro... 66 4e-10 ref|XP_012845525.1| PREDICTED: ninja-family protein mc410 [Eryth... 65 1e-09 gb|ALI87037.1| interactor of JAZ [Catharanthus roseus] 65 1e-09 gb|APR64182.1| hypothetical protein [Populus tomentosa] 64 2e-09 ref|XP_019199785.1| PREDICTED: ninja-family protein mc410 [Ipomo... 64 2e-09 ref|XP_011048351.1| PREDICTED: ninja-family protein mc410 [Popul... 64 2e-09 ref|XP_016578360.1| PREDICTED: ninja-family protein mc410 [Capsi... 64 2e-09 ref|XP_010049641.1| PREDICTED: ninja-family protein mc410 isofor... 62 1e-08 ref|XP_021608027.1| ninja-family protein mc410 [Manihot esculent... 62 1e-08 ref|XP_002325016.1| hypothetical protein POPTR_0018s09210g [Popu... 62 1e-08 gb|PNS93390.1| hypothetical protein POPTR_018G085100v3 [Populus ... 62 1e-08 gb|PAL65711.1| hypothetical protein CEJ83_20555, partial [Acinet... 57 2e-08 ref|XP_006412898.1| AFP homolog 2 [Eutrema salsugineum] >gi|5571... 61 3e-08 >gb|PIN11684.1| hypothetical protein CDL12_15714 [Handroanthus impetiginosus] Length = 500 Score = 73.2 bits (178), Expect = 1e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSP+EFVRHAAE+NN+ DA GLT Sbjct: 450 PTQIRIVCACHGSHMSPDEFVRHAAEDNNTPDAGTGLT 487 >ref|XP_011078285.1| ninja-family protein mc410 [Sesamum indicum] ref|XP_011078286.1| ninja-family protein mc410 [Sesamum indicum] ref|XP_020549572.1| ninja-family protein mc410 [Sesamum indicum] Length = 501 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAP-AGL 251 PTQIRIVCACHGSHMSPEEFVRHA EEN++ DA AGL Sbjct: 450 PTQIRIVCACHGSHMSPEEFVRHAGEENSTPDAAGAGL 487 >ref|XP_015076615.1| PREDICTED: ninja-family protein mc410 [Solanum pennellii] Length = 509 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSPEEFVRHA+EE S + AG++ Sbjct: 459 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGAGVS 496 >ref|XP_006338155.1| PREDICTED: ninja-family protein mc410 [Solanum tuberosum] Length = 509 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSPEEFVRHA+EE S + AG++ Sbjct: 459 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGAGVS 496 >ref|XP_004239269.1| PREDICTED: ninja-family protein mc410 [Solanum lycopersicum] Length = 509 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSPEEFVRHA+EE S + AG++ Sbjct: 459 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGAGVS 496 >gb|PHU15384.1| Ninja-family protein [Capsicum chinense] Length = 510 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSPEEFVRHA+EE S + AG++ Sbjct: 460 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGAGVS 497 >gb|PHT46263.1| Ninja-family protein [Capsicum baccatum] Length = 511 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 PTQIRIVCACHGSHMSPEEFVRHA+EE S + AG++ Sbjct: 461 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGAGVS 498 >gb|KZV15514.1| ninja-family protein mc410-like [Dorcoceras hygrometricum] Length = 505 Score = 66.2 bits (160), Expect = 4e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 PTQIRIVCACHGSHMSPEEF+ HA EEN++ ++ AGL Sbjct: 455 PTQIRIVCACHGSHMSPEEFIGHATEENSTQESGAGL 491 >ref|XP_012845525.1| PREDICTED: ninja-family protein mc410 [Erythranthe guttata] gb|EYU30732.1| hypothetical protein MIMGU_mgv1a006501mg [Erythranthe guttata] Length = 441 Score = 64.7 bits (156), Expect = 1e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSD 266 PTQ+RIVCACHGSHMSP+EFVRHA E+NN+ D Sbjct: 393 PTQVRIVCACHGSHMSPDEFVRHAGEDNNAPD 424 >gb|ALI87037.1| interactor of JAZ [Catharanthus roseus] Length = 500 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 PTQI+IVCACHG HMSPEEFVRHA+EE + D AGL Sbjct: 450 PTQIKIVCACHGIHMSPEEFVRHASEEQTNQDTGAGL 486 >gb|APR64182.1| hypothetical protein [Populus tomentosa] Length = 513 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 QIRIVCACHGSHMSPEEFVRHA+EEN + DA GL Sbjct: 465 QIRIVCACHGSHMSPEEFVRHASEENANPDASNGL 499 >ref|XP_019199785.1| PREDICTED: ninja-family protein mc410 [Ipomoea nil] Length = 507 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 358 TQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 TQI+IVCACHGSHMSPEEFVRHA+EE + D +G+T Sbjct: 458 TQIKIVCACHGSHMSPEEFVRHASEEQTTQDVGSGVT 494 >ref|XP_011048351.1| PREDICTED: ninja-family protein mc410 [Populus euphratica] Length = 507 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 QIRIVCACHGSHMSPEEFVRHA+EEN + DA GL Sbjct: 459 QIRIVCACHGSHMSPEEFVRHASEENANPDAGNGL 493 >ref|XP_016578360.1| PREDICTED: ninja-family protein mc410 [Capsicum annuum] ref|XP_016578361.1| PREDICTED: ninja-family protein mc410 [Capsicum annuum] gb|PHT79623.1| Ninja-family protein [Capsicum annuum] Length = 511 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 361 PTQIRIVCACHGSHMSPEEFVRHAAEENNSSDAPA 257 PTQIRIVCACHGSHMSPEEFVRHA+EE S + A Sbjct: 461 PTQIRIVCACHGSHMSPEEFVRHASEEQTSQEGGA 495 >ref|XP_010049641.1| PREDICTED: ninja-family protein mc410 isoform X1 [Eucalyptus grandis] gb|KCW82382.1| hypothetical protein EUGRSUZ_C03788 [Eucalyptus grandis] Length = 470 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 QI+IVCACHGSHMSPEEFVRHAAEE + D AGL+ Sbjct: 422 QIKIVCACHGSHMSPEEFVRHAAEEPANPDGGAGLS 457 >ref|XP_021608027.1| ninja-family protein mc410 [Manihot esculenta] ref|XP_021608028.1| ninja-family protein mc410 [Manihot esculenta] gb|OAY53806.1| hypothetical protein MANES_03G024900 [Manihot esculenta] Length = 512 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 QIRIVCACHGSHMSPEEF+RHA+EEN + D +GL Sbjct: 464 QIRIVCACHGSHMSPEEFIRHASEENVNPDNGSGL 498 >ref|XP_002325016.1| hypothetical protein POPTR_0018s09210g [Populus trichocarpa] gb|PNS93389.1| hypothetical protein POPTR_018G085100v3 [Populus trichocarpa] gb|PNS93391.1| hypothetical protein POPTR_018G085100v3 [Populus trichocarpa] Length = 512 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 QIRIVCACHG HMSPEEFVRHA+EEN + DA GL Sbjct: 464 QIRIVCACHGYHMSPEEFVRHASEENANPDAGNGL 498 >gb|PNS93390.1| hypothetical protein POPTR_018G085100v3 [Populus trichocarpa] Length = 513 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGL 251 QIRIVCACHG HMSPEEFVRHA+EEN + DA GL Sbjct: 465 QIRIVCACHGYHMSPEEFVRHASEENANPDAGNGL 499 >gb|PAL65711.1| hypothetical protein CEJ83_20555, partial [Acinetobacter baumannii] Length = 92 Score = 57.4 bits (137), Expect = 2e-08 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEEN 278 QIRIVCACHGSHMSPEEFVRHA++EN Sbjct: 44 QIRIVCACHGSHMSPEEFVRHASDEN 69 >ref|XP_006412898.1| AFP homolog 2 [Eutrema salsugineum] gb|ESQ54351.1| hypothetical protein EUTSA_v10025262mg [Eutrema salsugineum] Length = 430 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 355 QIRIVCACHGSHMSPEEFVRHAAEENNSSDAPAGLT 248 QI+IVCACHGSHMSPEEFVRHA+EE S +A G+T Sbjct: 389 QIKIVCACHGSHMSPEEFVRHASEEYVSPEASIGMT 424