BLASTX nr result
ID: Rehmannia31_contig00014704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014704 (725 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838908.1| PREDICTED: uncharacterized protein LOC105959... 57 6e-06 >ref|XP_012838908.1| PREDICTED: uncharacterized protein LOC105959367 [Erythranthe guttata] gb|EYU36512.1| hypothetical protein MIMGU_mgv11b022010mg [Erythranthe guttata] Length = 341 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 678 QRLLVMACGDEFSKLSADIAKETWVVGGIKDML 580 Q ++VM CG EFSKLS DIAKETWVVGGIKDML Sbjct: 301 QGVVVMRCGTEFSKLSDDIAKETWVVGGIKDML 333