BLASTX nr result
ID: Rehmannia31_contig00014509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014509 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22554.1| hypothetical protein CDL12_04747 [Handroanthus im... 65 5e-10 ref|XP_011076896.1| ethylene-responsive transcription factor ERF... 65 8e-10 ref|XP_011070810.1| ethylene-responsive transcription factor ERF... 59 2e-07 gb|KZV41407.1| hypothetical protein F511_37641 [Dorcoceras hygro... 55 3e-06 >gb|PIN22554.1| hypothetical protein CDL12_04747 [Handroanthus impetiginosus] Length = 341 Score = 65.5 bits (158), Expect = 5e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 357 NFDFDIEACNEALSWMDDAPTMMNGVSLNIACP 259 +FDFDI+ACNEA SWMDDAP +MNG SLNIACP Sbjct: 309 DFDFDIDACNEAFSWMDDAPPLMNGASLNIACP 341 >ref|XP_011076896.1| ethylene-responsive transcription factor ERF118 [Sesamum indicum] Length = 357 Score = 65.1 bits (157), Expect = 8e-10 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 360 FNFDFDIEACNEALSWMDDAPTMMNGVSLNIACP 259 F+FDFD++ACNEA +WMDDAPT+M+G +LNIACP Sbjct: 324 FDFDFDLDACNEAFAWMDDAPTLMSGATLNIACP 357 >ref|XP_011070810.1| ethylene-responsive transcription factor ERF118-like [Sesamum indicum] Length = 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -2 Query: 360 FNFDFDIEACNEALSWMDDAPTMMNGV-SLNIACP 259 F+FDF++EACNEAL+WMDD P +MNG LNIACP Sbjct: 320 FDFDFNLEACNEALAWMDDTPPLMNGAPPLNIACP 354 >gb|KZV41407.1| hypothetical protein F511_37641 [Dorcoceras hygrometricum] Length = 358 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = -2 Query: 357 NFDFDIEACNEALSWMDD-------APTMMNGVSLNIACP 259 +FDFD E+CNEAL+W+DD AP MMNG LNIACP Sbjct: 319 DFDFDFESCNEALAWIDDVTTPMNGAPPMMNGAPLNIACP 358