BLASTX nr result
ID: Rehmannia31_contig00014273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014273 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837842.1| PREDICTED: HD domain-containing protein 2 [E... 71 2e-12 ref|XP_009140501.1| PREDICTED: HD domain-containing protein 2-li... 71 4e-12 ref|XP_013743779.1| HD domain-containing protein 2 [Brassica nap... 71 4e-12 gb|POE57065.1| hypothetical protein CFP56_02091 [Quercus suber] 67 4e-12 ref|XP_013631208.1| PREDICTED: HD domain-containing protein 2-li... 71 4e-12 gb|KFK32703.1| hypothetical protein AALP_AA6G277800 [Arabis alpina] 70 7e-12 ref|XP_011069825.1| HD domain-containing protein 2 [Sesamum indi... 69 2e-11 ref|XP_018481010.1| PREDICTED: HD domain-containing protein 2-li... 69 2e-11 gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] 68 3e-11 ref|XP_006404869.1| HD domain-containing protein 2 [Eutrema sals... 69 3e-11 ref|XP_009117264.1| PREDICTED: HD domain-containing protein 2 [B... 68 4e-11 ref|XP_020265811.1| HD domain-containing protein 2-like [Asparag... 68 4e-11 ref|XP_010687679.1| PREDICTED: HD domain-containing protein 2 is... 67 8e-11 ref|XP_008361812.1| PREDICTED: HD domain-containing protein 2-li... 67 9e-11 ref|XP_010687675.1| PREDICTED: HD domain-containing protein 2 is... 67 9e-11 gb|POE57066.1| hd domain-containing protein 2 [Quercus suber] 67 1e-10 ref|XP_013708038.1| HD domain-containing protein 2-like [Brassic... 67 1e-10 ref|XP_021818846.1| HD domain-containing protein 2 [Prunus avium] 67 1e-10 ref|XP_008223575.1| PREDICTED: HD domain-containing protein 2 [P... 67 1e-10 ref|XP_013602157.1| PREDICTED: HD domain-containing protein 2-li... 67 1e-10 >ref|XP_012837842.1| PREDICTED: HD domain-containing protein 2 [Erythranthe guttata] gb|EYU37124.1| hypothetical protein MIMGU_mgv1a012883mg [Erythranthe guttata] gb|EYU37125.1| hypothetical protein MIMGU_mgv1a012883mg [Erythranthe guttata] Length = 237 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFFESTAGKFQTDLGKAWALE+ASRRRKQ Sbjct: 204 GKDLEEFFESTAGKFQTDLGKAWALEVASRRRKQ 237 >ref|XP_009140501.1| PREDICTED: HD domain-containing protein 2-like [Brassica rapa] Length = 256 Score = 70.9 bits (172), Expect = 4e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFFESTAGKFQTD+GKAWALEIASRRRKQ Sbjct: 222 GKDLEEFFESTAGKFQTDIGKAWALEIASRRRKQ 255 >ref|XP_013743779.1| HD domain-containing protein 2 [Brassica napus] ref|XP_022573880.1| HD domain-containing protein 2-like [Brassica napus] emb|CDY39676.1| BnaA04g13930D [Brassica napus] Length = 256 Score = 70.9 bits (172), Expect = 4e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFFESTAGKFQTD+GKAWALEIASRRRKQ Sbjct: 222 GKDLEEFFESTAGKFQTDIGKAWALEIASRRRKQ 255 >gb|POE57065.1| hypothetical protein CFP56_02091 [Quercus suber] Length = 68 Score = 66.6 bits (161), Expect = 4e-12 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDL+EFF+STAGKFQT+LGKAWALEIASRRRK+ Sbjct: 34 GKDLDEFFQSTAGKFQTELGKAWALEIASRRRKE 67 >ref|XP_013631208.1| PREDICTED: HD domain-containing protein 2-like [Brassica oleracea var. oleracea] ref|XP_013743834.1| HD domain-containing protein 2 [Brassica napus] emb|CDY20257.1| BnaC04g36990D [Brassica napus] Length = 258 Score = 70.9 bits (172), Expect = 4e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFFESTAGKFQTD+GKAWALEIASRRRKQ Sbjct: 223 GKDLEEFFESTAGKFQTDIGKAWALEIASRRRKQ 256 >gb|KFK32703.1| hypothetical protein AALP_AA6G277800 [Arabis alpina] Length = 222 Score = 69.7 bits (169), Expect = 7e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTD+GKAWALEIASRRRKQ Sbjct: 188 GKDLEEFFQSTAGKFQTDIGKAWALEIASRRRKQ 221 >ref|XP_011069825.1| HD domain-containing protein 2 [Sesamum indicum] Length = 237 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFFESTAGKFQTDLGKAWA E+ASRRRKQ Sbjct: 204 GKDLEEFFESTAGKFQTDLGKAWASEVASRRRKQ 237 >ref|XP_018481010.1| PREDICTED: HD domain-containing protein 2-like [Raphanus sativus] Length = 261 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 286 GKDLEEFFESTAGKFQTD+GKAWALEIASRRRK Sbjct: 226 GKDLEEFFESTAGKFQTDIGKAWALEIASRRRK 258 >gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] Length = 208 Score = 67.8 bits (164), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 286 GKDLEEFFESTAGKFQTD+GKAWALEIASRR+K Sbjct: 175 GKDLEEFFESTAGKFQTDIGKAWALEIASRRKK 207 >ref|XP_006404869.1| HD domain-containing protein 2 [Eutrema salsugineum] gb|ESQ46322.1| hypothetical protein EUTSA_v10000291mg [Eutrema salsugineum] Length = 264 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTD+GKAWALEIASRR+KQ Sbjct: 230 GKDLEEFFQSTAGKFQTDIGKAWALEIASRRKKQ 263 >ref|XP_009117264.1| PREDICTED: HD domain-containing protein 2 [Brassica rapa] emb|CDY68718.1| BnaAnng28140D [Brassica napus] Length = 247 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTD+GKAWALEIASRRRK+ Sbjct: 213 GKDLEEFFQSTAGKFQTDIGKAWALEIASRRRKR 246 >ref|XP_020265811.1| HD domain-containing protein 2-like [Asparagus officinalis] Length = 248 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTD+GKAWALEIASRRRK+ Sbjct: 214 GKDLEEFFQSTAGKFQTDVGKAWALEIASRRRKE 247 >ref|XP_010687679.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Beta vulgaris subsp. vulgaris] gb|KMT03517.1| hypothetical protein BVRB_8g191950 isoform A [Beta vulgaris subsp. vulgaris] Length = 207 Score = 66.6 bits (161), Expect = 8e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 286 GKDLEEFFESTAGKFQTD GKAWALEIASRR+K Sbjct: 174 GKDLEEFFESTAGKFQTDTGKAWALEIASRRKK 206 >ref|XP_008361812.1| PREDICTED: HD domain-containing protein 2-like [Malus domestica] Length = 263 Score = 67.4 bits (163), Expect = 9e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 286 GKDLEEFF+STAGKFQTDLGKAWALEIASRR+K Sbjct: 231 GKDLEEFFQSTAGKFQTDLGKAWALEIASRRKK 263 >ref|XP_010687675.1| PREDICTED: HD domain-containing protein 2 isoform X1 [Beta vulgaris subsp. vulgaris] ref|XP_010687676.1| PREDICTED: HD domain-containing protein 2 isoform X1 [Beta vulgaris subsp. vulgaris] ref|XP_010687677.1| PREDICTED: HD domain-containing protein 2 isoform X1 [Beta vulgaris subsp. vulgaris] ref|XP_010687678.1| PREDICTED: HD domain-containing protein 2 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT03518.1| hypothetical protein BVRB_8g191950 isoform B [Beta vulgaris subsp. vulgaris] Length = 211 Score = 66.6 bits (161), Expect = 9e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRK 286 GKDLEEFFESTAGKFQTD GKAWALEIASRR+K Sbjct: 178 GKDLEEFFESTAGKFQTDTGKAWALEIASRRKK 210 >gb|POE57066.1| hd domain-containing protein 2 [Quercus suber] Length = 221 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDL+EFF+STAGKFQT+LGKAWALEIASRRRK+ Sbjct: 187 GKDLDEFFQSTAGKFQTELGKAWALEIASRRRKE 220 >ref|XP_013708038.1| HD domain-containing protein 2-like [Brassica napus] Length = 242 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 G+DLEEFF+STAGKFQTD+GKAWALEIASRRRK+ Sbjct: 208 GQDLEEFFQSTAGKFQTDIGKAWALEIASRRRKR 241 >ref|XP_021818846.1| HD domain-containing protein 2 [Prunus avium] Length = 245 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTDLGKAWA E+ASRR+KQ Sbjct: 211 GKDLEEFFQSTAGKFQTDLGKAWASEVASRRKKQ 244 >ref|XP_008223575.1| PREDICTED: HD domain-containing protein 2 [Prunus mume] Length = 245 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 GKDLEEFF+STAGKFQTDLGKAWA E+ASRR+KQ Sbjct: 211 GKDLEEFFQSTAGKFQTDLGKAWASEVASRRKKQ 244 >ref|XP_013602157.1| PREDICTED: HD domain-containing protein 2-like [Brassica oleracea var. oleracea] Length = 248 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 384 GKDLEEFFESTAGKFQTDLGKAWALEIASRRRKQ 283 G+DLEEFF+STAGKFQTD+GKAWALEIASRRRK+ Sbjct: 214 GQDLEEFFQSTAGKFQTDIGKAWALEIASRRRKR 247