BLASTX nr result
ID: Rehmannia31_contig00014091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014091 (751 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN25875.1| hypothetical protein CDL12_01392 [Handroanthus im... 86 7e-17 ref|XP_011079836.1| protein trichome birefringence-like 11 [Sesa... 87 7e-16 gb|PKI31282.1| hypothetical protein CRG98_048329 [Punica granatum] 81 2e-15 ref|XP_011082551.1| protein trichome birefringence-like 11 isofo... 84 7e-15 gb|EYU46596.1| hypothetical protein MIMGU_mgv1a006590mg [Erythra... 83 1e-14 ref|XP_012832492.1| PREDICTED: protein trichome birefringence-li... 83 1e-14 gb|EFH58707.1| hypothetical protein ARALYDRAFT_896717 [Arabidops... 76 3e-14 gb|PHU16425.1| Protein trichome birefringence-like 11 [Capsicum ... 82 5e-14 gb|PHT80499.1| Protein trichome birefringence-like 11 [Capsicum ... 82 5e-14 gb|PHT46978.1| Protein trichome birefringence-like 11 [Capsicum ... 82 5e-14 ref|XP_016577377.1| PREDICTED: protein trichome birefringence-li... 82 5e-14 ref|XP_019197442.1| PREDICTED: protein trichome birefringence-li... 82 5e-14 gb|OWM69844.1| hypothetical protein CDL15_Pgr025693 [Punica gran... 81 7e-14 emb|CBI32367.3| unnamed protein product, partial [Vitis vinifera] 81 8e-14 ref|XP_019247787.1| PREDICTED: protein trichome birefringence-li... 81 9e-14 ref|XP_016450721.1| PREDICTED: protein trichome birefringence-li... 81 9e-14 ref|XP_009627017.1| PREDICTED: protein trichome birefringence-li... 81 9e-14 ref|XP_002272356.2| PREDICTED: protein trichome birefringence-li... 81 9e-14 dbj|GAY40711.1| hypothetical protein CUMW_054100 [Citrus unshiu] 81 9e-14 gb|KDO68769.1| hypothetical protein CISIN_1g011120mg [Citrus sin... 81 9e-14 >gb|PIN25875.1| hypothetical protein CDL12_01392 [Handroanthus impetiginosus] Length = 203 Score = 86.3 bits (212), Expect = 7e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGRV 127 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLK+ IS GR+ Sbjct: 164 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKQGISHGRI 203 >ref|XP_011079836.1| protein trichome birefringence-like 11 [Sesamum indicum] Length = 475 Score = 87.0 bits (214), Expect = 7e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGRV 127 GPAP+HRQDCSHWCLPGVPDSWNELLYAVFLKREIS+ RV Sbjct: 436 GPAPVHRQDCSHWCLPGVPDSWNELLYAVFLKREISRRRV 475 >gb|PKI31282.1| hypothetical protein CRG98_048329 [Punica granatum] Length = 155 Score = 80.9 bits (198), Expect = 2e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREI 112 GPAP+HRQDCSHWCLPGVPDSWNELLYA+FLKRE+ Sbjct: 119 GPAPMHRQDCSHWCLPGVPDSWNELLYALFLKREL 153 >ref|XP_011082551.1| protein trichome birefringence-like 11 isoform X1 [Sesamum indicum] Length = 441 Score = 84.0 bits (206), Expect = 7e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQG 121 GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLKR IS+G Sbjct: 404 GPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRGISRG 441 >gb|EYU46596.1| hypothetical protein MIMGU_mgv1a006590mg [Erythranthe guttata] Length = 438 Score = 83.2 bits (204), Expect = 1e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGRV 127 GPAP+HRQDCSHWCLPGVPDSWNELLYAV LKREI + R+ Sbjct: 399 GPAPIHRQDCSHWCLPGVPDSWNELLYAVILKREIQKRRI 438 >ref|XP_012832492.1| PREDICTED: protein trichome birefringence-like 11 [Erythranthe guttata] Length = 442 Score = 83.2 bits (204), Expect = 1e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGRV 127 GPAP+HRQDCSHWCLPGVPDSWNELLYAV LKREI + R+ Sbjct: 403 GPAPIHRQDCSHWCLPGVPDSWNELLYAVILKREIQKRRI 442 >gb|EFH58707.1| hypothetical protein ARALYDRAFT_896717 [Arabidopsis lyrata subsp. lyrata] Length = 84 Score = 75.9 bits (185), Expect = 3e-14 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRE 109 GPAPLHRQDCSHWCLPGVPD+WNEL YA+F+K+E Sbjct: 19 GPAPLHRQDCSHWCLPGVPDTWNELFYALFMKQE 52 >gb|PHU16425.1| Protein trichome birefringence-like 11 [Capsicum chinense] Length = 457 Score = 81.6 bits (200), Expect = 5e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ + Sbjct: 413 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELARAK 451 >gb|PHT80499.1| Protein trichome birefringence-like 11 [Capsicum annuum] Length = 457 Score = 81.6 bits (200), Expect = 5e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ + Sbjct: 413 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELARAK 451 >gb|PHT46978.1| Protein trichome birefringence-like 11 [Capsicum baccatum] Length = 457 Score = 81.6 bits (200), Expect = 5e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ + Sbjct: 413 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELARAK 451 >ref|XP_016577377.1| PREDICTED: protein trichome birefringence-like 10 [Capsicum annuum] Length = 457 Score = 81.6 bits (200), Expect = 5e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ + Sbjct: 413 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELARAK 451 >ref|XP_019197442.1| PREDICTED: protein trichome birefringence-like 11 [Ipomoea nil] Length = 471 Score = 81.6 bits (200), Expect = 5e-14 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREI 112 GPAPLHRQDCSHWCLPGVPDSWNELLYAVF+KRE+ Sbjct: 408 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFVKREL 442 >gb|OWM69844.1| hypothetical protein CDL15_Pgr025693 [Punica granatum] Length = 459 Score = 81.3 bits (199), Expect = 7e-14 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREI 112 GPAP+HRQDCSHWCLPGVPDSWNELLYA+FLKRE+ Sbjct: 415 GPAPMHRQDCSHWCLPGVPDSWNELLYALFLKREV 449 >emb|CBI32367.3| unnamed protein product, partial [Vitis vinifera] Length = 419 Score = 80.9 bits (198), Expect = 8e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRE 109 GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLKRE Sbjct: 365 GPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRE 398 >ref|XP_019247787.1| PREDICTED: protein trichome birefringence-like 10 [Nicotiana attenuata] gb|OIT02479.1| protein trichome birefringence-like 10 [Nicotiana attenuata] Length = 456 Score = 80.9 bits (198), Expect = 9e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQ 118 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ Sbjct: 412 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELAR 448 >ref|XP_016450721.1| PREDICTED: protein trichome birefringence-like 10 [Nicotiana tabacum] Length = 459 Score = 80.9 bits (198), Expect = 9e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQ 118 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ Sbjct: 412 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELAR 448 >ref|XP_009627017.1| PREDICTED: protein trichome birefringence-like 10 [Nicotiana tomentosiformis] Length = 459 Score = 80.9 bits (198), Expect = 9e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQ 118 GPAPLHRQDCSHWCLPGVPD+WNELLYA FLKRE+++ Sbjct: 412 GPAPLHRQDCSHWCLPGVPDTWNELLYATFLKRELAR 448 >ref|XP_002272356.2| PREDICTED: protein trichome birefringence-like 10 [Vitis vinifera] Length = 463 Score = 80.9 bits (198), Expect = 9e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKRE 109 GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLKRE Sbjct: 409 GPAPLHRQDCSHWCLPGVPDSWNELLYALFLKRE 442 >dbj|GAY40711.1| hypothetical protein CUMW_054100 [Citrus unshiu] Length = 467 Score = 80.9 bits (198), Expect = 9e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLK+E S + Sbjct: 419 GPAPLHRQDCSHWCLPGVPDSWNELLYALFLKQETSHAQ 457 >gb|KDO68769.1| hypothetical protein CISIN_1g011120mg [Citrus sinensis] Length = 493 Score = 80.9 bits (198), Expect = 9e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 8 GPAPLHRQDCSHWCLPGVPDSWNELLYAVFLKREISQGR 124 GPAPLHRQDCSHWCLPGVPDSWNELLYA+FLK+E S + Sbjct: 445 GPAPLHRQDCSHWCLPGVPDSWNELLYALFLKQETSHAQ 483