BLASTX nr result
ID: Rehmannia31_contig00014075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00014075 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus im... 56 2e-06 >gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus impetiginosus] Length = 735 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 403 HGLMEARGFVSSQQLKIAMMASQAMGKSSKRNKFSLIRD 287 HGLMEARGFV S++LK+A++A + +GKS K NK SL+RD Sbjct: 696 HGLMEARGFVLSERLKVALLARETVGKSDKSNKSSLVRD 734