BLASTX nr result
ID: Rehmannia31_contig00013788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00013788 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16097.1| hypothetical protein CDL12_11253 [Handroanthus im... 62 7e-17 gb|PIN11048.1| hypothetical protein CDL12_16357 [Handroanthus im... 62 9e-17 gb|PIN11050.1| hypothetical protein CDL12_16359 [Handroanthus im... 64 9e-17 emb|CDP00466.1| unnamed protein product [Coffea canephora] 60 8e-15 gb|PHU02230.1| hypothetical protein BC332_27481 [Capsicum chinense] 55 3e-12 gb|PIN16099.1| hypothetical protein CDL12_11255 [Handroanthus im... 62 4e-10 gb|PIN11051.1| hypothetical protein CDL12_16360 [Handroanthus im... 48 5e-10 gb|PIN16098.1| hypothetical protein CDL12_11254 [Handroanthus im... 62 2e-09 gb|PIN11052.1| hypothetical protein CDL12_16361 [Handroanthus im... 48 2e-09 gb|OIT36865.1| hypothetical protein A4A49_36404 [Nicotiana atten... 55 6e-07 ref|XP_010650051.1| PREDICTED: uncharacterized protein LOC104879... 42 2e-06 gb|PHU02236.1| hypothetical protein BC332_27487 [Capsicum chinense] 55 3e-06 gb|OIT36377.1| hypothetical protein A4A49_10461 [Nicotiana atten... 55 3e-06 ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975... 45 4e-06 >gb|PIN16097.1| hypothetical protein CDL12_11253 [Handroanthus impetiginosus] Length = 121 Score = 61.6 bits (148), Expect(2) = 7e-17 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 136 GTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQLC 17 G KMMKAPGRN + RS+F +DP+ YF NLR HPGD+LC Sbjct: 82 GRAKMMKAPGRNTRMRRSVFEADPRGYFQNLRSHPGDELC 121 Score = 53.1 bits (126), Expect(2) = 7e-17 Identities = 29/61 (47%), Positives = 36/61 (59%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 193 MG +E+MK V++KLKEAL LA+EN G +ALAWFD VFPP+T Sbjct: 1 MGFDEVMKSVVEKLKEAL--------------------LAVENWGADALAWFDGVFPPDT 40 Query: 192 R 190 R Sbjct: 41 R 41 >gb|PIN11048.1| hypothetical protein CDL12_16357 [Handroanthus impetiginosus] Length = 243 Score = 62.4 bits (150), Expect(2) = 9e-17 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 38/99 (38%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEA-----------LFFMENVFPPETWKENISQW------------ 262 MG +E+MK V +KLKEA L + E +FPP+T E I W Sbjct: 1 MGFDEVMKSVWEKLKEAVLAVPKWGAESLAWFEGLFPPDTGGEKIKHWFHVAQLYLVEMR 60 Query: 261 ---------------LLALENSGGEALAWFDKVFPPETR 190 LLA+EN G EALAWFD VFPPETR Sbjct: 61 FDEVIRSVREKLKEALLAMENWGAEALAWFDGVFPPETR 99 Score = 52.0 bits (123), Expect(2) = 9e-17 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -2 Query: 136 GTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQ 23 G VKMMKAPGRN +PR F DPK YF LR HPG + Sbjct: 136 GGVKMMKAPGRNRRMPRRDFEIDPKGYFQKLRSHPGSE 173 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -2 Query: 136 GTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPG 29 G KMMKAPGRN+ IPRS F D K YF NLR HPG Sbjct: 208 GRGKMMKAPGRNLRIPRSHFEIDSKGYFQNLRYHPG 243 >gb|PIN11050.1| hypothetical protein CDL12_16359 [Handroanthus impetiginosus] Length = 146 Score = 64.3 bits (155), Expect(2) = 9e-17 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 11/72 (15%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMEN-----------VFPPETWKENISQWLLALENSGGEAL 226 M +E+MK V +KLKEAL +E FPP+T +E + + LLA+EN + L Sbjct: 1 MAFDEVMKSVGEKLKEALLAVEKWGAEALAWFDGAFPPDTRREKLKEALLAVENGRAKVL 60 Query: 225 AWFDKVFPPETR 190 AWFD VFPPETR Sbjct: 61 AWFDGVFPPETR 72 Score = 50.1 bits (118), Expect(2) = 9e-17 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 130 VKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPG 29 VKMMKAPG+N +PR F ++PK YF NLR HPG Sbjct: 113 VKMMKAPGKNHRMPRRDFENNPKGYFQNLRSHPG 146 >emb|CDP00466.1| unnamed protein product [Coffea canephora] Length = 119 Score = 60.1 bits (144), Expect(2) = 8e-15 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 130 VKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQLC 17 VKMMKAPGRN + R F ++PK+YF NLR HPGDQLC Sbjct: 82 VKMMKAPGRNCTMARPAFEANPKSYFRNLRAHPGDQLC 119 Score = 47.8 bits (112), Expect(2) = 8e-15 Identities = 26/61 (42%), Positives = 34/61 (55%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 193 MG+E + KFV++KLKE W+ A+EN G+ L WFDK+FPPET Sbjct: 1 MGIESVEKFVVEKLKEL------------WQ--------AMENLWGQFLEWFDKIFPPET 40 Query: 192 R 190 R Sbjct: 41 R 41 >gb|PHU02230.1| hypothetical protein BC332_27481 [Capsicum chinense] Length = 115 Score = 55.5 bits (132), Expect(2) = 3e-12 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = -2 Query: 139 RGTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGD 26 R KMMKAPGRNI IPRS F +P+ YF NLR +PGD Sbjct: 75 RSNSKMMKAPGRNIRIPRSGFEKNPRLYFTNLRAYPGD 112 Score = 43.9 bits (102), Expect(2) = 3e-12 Identities = 23/59 (38%), Positives = 31/59 (52%) Frame = -3 Query: 366 MEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPETR 190 M E+M F+++KLKEA+ M N GG ++WFD+VFPPETR Sbjct: 1 MVEVMSFLMEKLKEAILMMFNF--------------------GGHLMSWFDEVFPPETR 39 >gb|PIN16099.1| hypothetical protein CDL12_11255 [Handroanthus impetiginosus] Length = 75 Score = 62.0 bits (149), Expect = 4e-10 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -2 Query: 139 RGTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQLC 17 R VKMMKAPGRN +PR F DPK YF NLR HPGD+LC Sbjct: 35 RRLVKMMKAPGRNFQMPRRDFEIDPKGYFQNLRSHPGDKLC 75 >gb|PIN11051.1| hypothetical protein CDL12_16360 [Handroanthus impetiginosus] Length = 166 Score = 48.1 bits (113), Expect(2) = 5e-10 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = -2 Query: 136 GTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHP 32 G VKMMKAPGRN+ +PR F +P+ YF LR HP Sbjct: 131 GRVKMMKAPGRNLRMPRRDFEINPRGYFQRLRSHP 165 Score = 43.5 bits (101), Expect(2) = 5e-10 Identities = 27/61 (44%), Positives = 32/61 (52%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 193 M +E+MK V +KLKEAL LA+ N G EALAWFD VFPP+ Sbjct: 53 MRFDEVMKSVGEKLKEAL--------------------LAVGNWGAEALAWFDGVFPPDR 92 Query: 192 R 190 R Sbjct: 93 R 93 >gb|PIN16098.1| hypothetical protein CDL12_11254 [Handroanthus impetiginosus] Length = 131 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -2 Query: 139 RGTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQLC 17 R VKMMKAPGRN +PR F DPK YF NLR HPGD+LC Sbjct: 91 RRLVKMMKAPGRNFQMPRRDFEIDPKGYFQNLRSHPGDKLC 131 >gb|PIN11052.1| hypothetical protein CDL12_16361 [Handroanthus impetiginosus] Length = 181 Score = 47.8 bits (112), Expect(2) = 2e-09 Identities = 28/61 (45%), Positives = 33/61 (54%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 193 M +E+ K V +KLKEALF A+EN G EALAWFD VFPP+T Sbjct: 1 MRFDEVKKSVGEKLKEALF--------------------AVENWGAEALAWFDSVFPPDT 40 Query: 192 R 190 R Sbjct: 41 R 41 Score = 41.6 bits (96), Expect(2) = 2e-09 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = -2 Query: 136 GTVKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPG 29 G VKM K+PGRN +PR F +P+ YF LR H G Sbjct: 79 GMVKMTKSPGRNRRMPRRDFEINPRGYFQRLRSHHG 114 >gb|OIT36865.1| hypothetical protein A4A49_36404 [Nicotiana attenuata] Length = 121 Score = 55.1 bits (131), Expect = 6e-07 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 127 KMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQL 20 K MKAPGRN +PR+ F SDP++YF NLR +PGD+L Sbjct: 85 KTMKAPGRNCRMPRNTFESDPRSYFRNLRAYPGDEL 120 >ref|XP_010650051.1| PREDICTED: uncharacterized protein LOC104879282 [Vitis vinifera] Length = 115 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 27/73 (36%), Positives = 34/73 (46%) Frame = -3 Query: 372 MGMEEMMKFVIDKLKEALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPET 193 MG E +MKFV++KLKE L+ LEN GG + DKVFPP++ Sbjct: 1 MGAESVMKFVVEKLKEL--------------------LVLLENFGGYLVDEVDKVFPPDS 40 Query: 192 RXXXXXXXSAVGA 154 R VGA Sbjct: 41 RGEKLRHWIQVGA 53 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -2 Query: 139 RGTVKMMKAPGRNIMIPRSLFASDPKAYFANLR 41 R VKMMKAPGR+ + R F S+P+ YF LR Sbjct: 76 RRGVKMMKAPGRDYRMARPPFESNPRGYFRGLR 108 >gb|PHU02236.1| hypothetical protein BC332_27487 [Capsicum chinense] Length = 303 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 130 VKMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQL 20 VKMMKAPGRNI+IPRS F +P+ YF LR +PGD L Sbjct: 266 VKMMKAPGRNIIIPRSSFEINPRLYFIKLRAYPGDML 302 >gb|OIT36377.1| hypothetical protein A4A49_10461 [Nicotiana attenuata] Length = 309 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 127 KMMKAPGRNIMIPRSLFASDPKAYFANLRLHPGDQL 20 KMMKAPGRNI+IPR F ++PK YF NLR +PGD L Sbjct: 273 KMMKAPGRNIIIPRFDFEANPKLYFINLRAYPGDML 308 >ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975481 [Musa acuminata subsp. malaccensis] Length = 142 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -2 Query: 142 SRGTVKMMKAPGRN-IMIPRSLFASDPKAYFANLR 41 SRGT +MM+APGR+ ++PR+ F SDP+ YF NLR Sbjct: 101 SRGTGRMMRAPGRHGAVMPRASFESDPRGYFINLR 135 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = -3 Query: 366 MEEMMKFVIDKLKE---ALFFMENVFPPETWKENISQWLLALENSGGEALAWFDKVFPPE 196 ME + K +++K +E A E+V E KE ++Q + L+++ G D VFPPE Sbjct: 1 MEGLRKLLVEKAREVKGADELKESV--TEFVKEKLAQLIHVLQDAIGFLAEKLDLVFPPE 58 Query: 195 TRXXXXXXXSAVGAVGVFP 139 TR VG V P Sbjct: 59 TRAETLHRWLHVGLTVVLP 77