BLASTX nr result
ID: Rehmannia31_contig00013741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00013741 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019158110.1| PREDICTED: potassium transporter 6-like [Ipo... 56 2e-06 gb|PIN10086.1| hypothetical protein CDL12_17329 [Handroanthus im... 55 5e-06 ref|XP_009768503.1| PREDICTED: potassium transporter 6-like [Nic... 54 9e-06 >ref|XP_019158110.1| PREDICTED: potassium transporter 6-like [Ipomoea nil] Length = 802 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 308 LRGFSMDLESGSYQNQLKKESWRTILTLAYQSL 406 LRGF+MDLE+G QN LK++SWRT+LTLAYQSL Sbjct: 17 LRGFAMDLETGFRQNSLKRQSWRTVLTLAYQSL 49 >gb|PIN10086.1| hypothetical protein CDL12_17329 [Handroanthus impetiginosus] Length = 771 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 323 MDLESGSYQNQLKKESWRTILTLAYQSL 406 MDLE G+YQNQ+KKESWRTILTLAYQSL Sbjct: 1 MDLERGTYQNQVKKESWRTILTLAYQSL 28 >ref|XP_009768503.1| PREDICTED: potassium transporter 6-like [Nicotiana sylvestris] ref|XP_016471345.1| PREDICTED: potassium transporter 6-like [Nicotiana tabacum] Length = 779 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 323 MDLESGSYQNQLKKESWRTILTLAYQSL 406 MDLE+G YQN+LKKESWRTILTLAYQSL Sbjct: 1 MDLETGFYQNRLKKESWRTILTLAYQSL 28