BLASTX nr result
ID: Rehmannia31_contig00013556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00013556 (2090 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009344458.1| ribosomal protein S18 (chloroplast) [Rehmann... 196 4e-56 ref|YP_009309473.1| ribosomal protein S18 (chloroplast) [Paulown... 193 3e-55 ref|YP_009254237.1| ribosomal protein S18 (chloroplast) [Erythra... 192 8e-55 ref|YP_009365682.1| ribosomal protein S18 (plastid) [Digitalis l... 192 1e-54 ref|YP_003359381.1| ribosomal protein S18 (chloroplast) [Olea eu... 191 1e-54 ref|YP_740139.1| ribosomal protein S18 (chloroplast) [Daucus car... 191 1e-54 ref|YP_009379635.1| ribosomal protein S18 (chloroplast) [Hydrang... 191 2e-54 ref|YP_009459634.1| ribosomal protein S18 (chloroplast) [Scrophu... 191 2e-54 ref|YP_007507133.1| ribosomal protein S18 (chloroplast) [Salvia ... 191 2e-54 ref|YP_009294885.1| ribosomal protein S18 (plastid) [Veronica na... 191 3e-54 gb|APB94050.1| ribosomal protein S18 (plastid) [Daucus carota su... 190 4e-54 ref|YP_009338448.1| ribosomal protein S18 (chloroplast) [Pterygo... 190 4e-54 ref|YP_009232851.1| ribosomal protein S18 (chloroplast) [Angelic... 190 4e-54 ref|YP_009232766.1| ribosomal protein S18 (chloroplast) [Angelic... 190 4e-54 ref|YP_009388792.1| ribosomal protein S18 (chloroplast) [Ocimum ... 190 5e-54 gb|APB96005.1| ribosomal protein S18 (plastid) [Daucus pusillus]... 190 5e-54 gb|AKZ24382.1| ribosomal protein S18 (plastid) [Cicuta maculata] 190 5e-54 gb|ADD30019.1| ribosomal protein S18 (chloroplast) [Heuchera san... 190 5e-54 ref|YP_009462452.1| ribosomal protein S18 (chloroplast) [Syringa... 189 7e-54 gb|ADD30002.1| ribosomal protein S18 (chloroplast) [Aucuba japon... 189 7e-54 >ref|YP_009344458.1| ribosomal protein S18 (chloroplast) [Rehmannia chingii] ref|YP_009353964.1| ribosomal protein S18 (chloroplast) [Rehmannia glutinosa] ref|YP_009354052.1| ribosomal protein S18 (chloroplast) [Rehmannia henryi] ref|YP_009354139.1| ribosomal protein S18 (chloroplast) [Rehmannia solanifolia] ref|YP_009354227.1| ribosomal protein S18 (chloroplast) [Rehmannia piasezkii] ref|YP_009354314.1| ribosomal protein S18 (chloroplast) [Rehmannia elata] gb|APT42286.1| ribosomal protein S18 (chloroplast) [Rehmannia chingii] gb|AQZ40527.1| ribosomal protein S18 (chloroplast) [Rehmannia glutinosa] gb|AQZ40614.1| ribosomal protein S18 (chloroplast) [Rehmannia henryi] gb|AQZ40702.1| ribosomal protein S18 (chloroplast) [Rehmannia solanifolia] gb|AQZ40789.1| ribosomal protein S18 (chloroplast) [Rehmannia piasezkii] gb|AQZ40876.1| ribosomal protein S18 (chloroplast) [Rehmannia elata] Length = 101 Score = 196 bits (497), Expect = 4e-56 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 101 >ref|YP_009309473.1| ribosomal protein S18 (chloroplast) [Paulownia coreana] ref|YP_009309560.1| ribosomal protein S18 (chloroplast) [Paulownia tomentosa] gb|AKM21534.1| ribosomal protein S18 (chloroplast) [Paulownia coreana] gb|AKM21621.1| ribosomal protein S18 (chloroplast) [Paulownia tomentosa] Length = 101 Score = 193 bits (491), Expect = 3e-55 Identities = 100/101 (99%), Positives = 100/101 (99%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRNK 101 >ref|YP_009254237.1| ribosomal protein S18 (chloroplast) [Erythranthe lutea] gb|ANC62937.1| ribosomal protein S18 (chloroplast) [Erythranthe lutea] Length = 103 Score = 192 bits (488), Expect = 8e-55 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRNK 101 >ref|YP_009365682.1| ribosomal protein S18 (plastid) [Digitalis lanata] gb|ARJ61214.1| ribosomal protein S18 (plastid) [Digitalis lanata] Length = 101 Score = 192 bits (487), Expect = 1e-54 Identities = 99/101 (98%), Positives = 100/101 (99%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTEST+RT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTSRTTGLRTRNK 101 >ref|YP_003359381.1| ribosomal protein S18 (chloroplast) [Olea europaea] ref|YP_004376443.1| ribosomal protein S18 [Olea europaea subsp. europaea] ref|YP_004563803.1| ribosomal protein S18 [Olea europaea subsp. cuspidata] ref|YP_004564026.1| ribosomal protein S18 [Olea woodiana subsp. woodiana] ref|YP_004564519.1| ribosomal protein S18 [Olea europaea subsp. maroccana] ref|YP_004935688.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] ref|YP_009110624.1| ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] ref|YP_009309896.1| ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] ref|YP_009383750.1| ribosomal protein S18 (chloroplast) [Chionanthus retusus] ref|YP_009434701.1| 30S ribosomal protein S18 (chloroplast) [Sinowilsonia henryi] ref|YP_009443968.1| ribosomal protein S18 (chloroplast) [Forsythia suspensa] ref|YP_009461749.1| ribosomal protein S18 (chloroplast) [Chionanthus parkinsonii] ref|YP_009461925.1| ribosomal protein S18 (chloroplast) [Forestiera isabelae] ref|YP_009462013.1| ribosomal protein S18 (chloroplast) [Forsythia x intermedia] ref|YP_009462100.1| ribosomal protein S18 (chloroplast) [Nestegis apetala] ref|YP_009462188.1| ribosomal protein S18 (chloroplast) [Noronhia lowryi] ref|YP_009462276.1| ribosomal protein S18 (chloroplast) [Olea exasperata] ref|YP_009462364.1| ribosomal protein S18 (chloroplast) [Schrebera arborea] ref|YP_009468629.1| 30S ribosomal protein S18 (plastid) [Fraxinus chiisanensis] gb|ABG74753.1| ribosomal protein S18 (chloroplast) [Forsythia europaea] gb|ABG74806.1| ribosomal protein S18 (chloroplast) [Jasminum abyssinicum] gb|ADA69948.1| ribosomal protein S18 (chloroplast) [Olea europaea] gb|ADD30001.1| ribosomal protein S18 (chloroplast) [Antirrhinum majus] gb|ADD72111.1| ribosomal protein S18 (chloroplast) [Olea europaea] emb|CBR30337.1| ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] emb|CBR23852.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR24645.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] emb|CBR30428.1| ribosomal protein S18 (plastid) [Olea europaea subsp. europaea] emb|CBS29374.1| ribosomal protein S18 (chloroplast) [Olea woodiana subsp. woodiana] emb|CBS29264.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. maroccana] emb|CBJ04320.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] emb|CBR23761.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] gb|AEO92728.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] gb|AGL45358.1| ribosomal protein S18 (chloroplast) [Sesamum indicum] emb|CCQ09124.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] emb|CED79784.1| ribosomal protein S18 (chloroplast) [Hesperelaea palmeri] gb|AKZ24371.1| ribosomal protein S18 (plastid) [Penstemon angustifolius] gb|AKZ24372.1| ribosomal protein S18 (plastid) [Penstemon gracilis] gb|ALZ50039.1| ribosomal protein S18 (chloroplast) [Abeliophyllum distichum] gb|ARS43923.1| ribosomal protein S18 (chloroplast) [Chionanthus retusus] gb|ATG24500.1| 30S ribosomal protein S18 (chloroplast) [Sinowilsonia henryi] gb|ATU07188.1| ribosomal protein S18 (chloroplast) [Forsythia suspensa] gb|AUF33749.1| ribosomal protein S18 (chloroplast) [Fouquieria diguetii] gb|AUT83898.1| ribosomal protein S18 (chloroplast) [Chionanthus parkinsonii] gb|AUT84074.1| ribosomal protein S18 (chloroplast) [Fontanesia phillyreoides subsp. fortunei] gb|AUT84161.1| ribosomal protein S18 (chloroplast) [Forestiera isabelae] gb|AUT84249.1| ribosomal protein S18 (chloroplast) [Forsythia x intermedia] gb|AUT84335.1| ribosomal protein S18 (chloroplast) [Fraxinus ornus] gb|AUT84423.1| ribosomal protein S18 (chloroplast) [Nestegis apetala] gb|AUT84511.1| ribosomal protein S18 (chloroplast) [Noronhia lowryi] gb|AUT84599.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. cuspidata] gb|AUT84686.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84775.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84863.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. europaea] gb|AUT84951.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. guanchica] gb|AUT85039.1| ribosomal protein S18 (chloroplast) [Olea europaea subsp. laperrinei] gb|AUT85126.1| ribosomal protein S18 (chloroplast) [Olea exasperata] gb|AUT85214.1| ribosomal protein S18 (chloroplast) [Schrebera arborea] gb|AVA09417.1| 30S ribosomal protein S18 (plastid) [Fraxinus chiisanensis] gb|AVE14962.1| ribosomal protein S18 (chloroplast) [Forsythia saxatilis] gb|AVM38758.1| ribosomal protein S18 (chloroplast) [Fraxinus excelsior] Length = 101 Score = 191 bits (486), Expect = 1e-54 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTEST RT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTTGLRTRNK 101 >ref|YP_740139.1| ribosomal protein S18 (chloroplast) [Daucus carota] ref|YP_009155316.1| ribosomal protein S18 (plastid) [Seseli montanum] ref|YP_009186275.1| ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] ref|YP_009232936.1| ribosomal protein S18 (chloroplast) [Angelica gigas] ref|YP_009233021.1| ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] ref|YP_009235901.1| ribosomal protein S18 (chloroplast) [Foeniculum vulgare] ref|YP_009235986.1| ribosomal protein S18 (chloroplast) [Anethum graveolens] ref|YP_009243588.1| ribosomal protein S18 (chloroplast) [Coriandrum sativum] ref|YP_009331719.1| ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] ref|YP_009338363.1| ribosomal protein S18 (chloroplast) [Peucedanum insolens] ref|YP_009363699.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] sp|Q0G9U0.1|RR18_DAUCA RecName: Full=30S ribosomal protein S18, chloroplastic gb|ABI32446.1| ribosomal protein S18 (chloroplast) [Daucus carota] gb|ABU85200.1| ribosomal protein S18, partial (chloroplast) [Anethum graveolens] gb|ADK89800.1| ribosomal protein S18 (chloroplast) [Tiedemannia filiformis subsp. greenmannii] gb|AIU99124.1| ribosomal protein S18 (plastid) [Seseli montanum] gb|AKS03638.1| ribosomal protein S18 (chloroplast) [Coriandrum sativum] gb|AKZ24384.1| ribosomal protein S18 (plastid) [Zizia aurea] gb|ALN96870.1| ribosomal protein S18 (chloroplast) [Angelica decursiva] gb|ALO71647.1| ribosomal protein S18 (chloroplast) [Ostericum grosseserratum] gb|AMA98028.1| ribosomal protein S18 (chloroplast) [Angelica gigas] gb|AMA98114.1| ribosomal protein S18 (chloroplast) [Ligusticum tenuissimum] gb|AMD83937.1| ribosomal protein S18 (chloroplast) [Foeniculum vulgare] gb|AMD84022.1| ribosomal protein S18 (chloroplast) [Anethum graveolens] gb|KZM81244.1| ribosomal protein S18 (plastid) [Daucus carota subsp. sativus] gb|ANK36458.1| ribosomal protein S18 (chloroplast) [Peucedanum insolens] gb|ANS72052.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] gb|AOT84686.1| ribosomal protein S18 (chloroplast) [Glehnia littoralis] gb|APB93625.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB93710.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB93795.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB93880.1| ribosomal protein S18 (plastid) [Daucus carota subsp. capillifolius] gb|APB93965.1| ribosomal protein S18 (plastid) [Daucus carota subsp. maximus] gb|APB94135.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB94220.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] gb|APB94305.1| ribosomal protein S18 (plastid) [Daucus carota subsp. carota] gb|APB94390.1| ribosomal protein S18 (plastid) [Daucus carota subsp. maximus] gb|APB94475.1| ribosomal protein S18 (plastid) [Daucus syrticus] gb|APB94560.1| ribosomal protein S18 (plastid) [Daucus syrticus] gb|APB94645.1| ribosomal protein S18 (plastid) [Daucus rouyi] gb|APB94730.1| ribosomal protein S18 (plastid) [Daucus pumilus] gb|APB94815.1| ribosomal protein S18 (plastid) [Daucus aureus] gb|APB94900.1| ribosomal protein S18 (plastid) [Daucus muricatus] gb|APB94985.1| ribosomal protein S18 (plastid) [Daucus muricatus] gb|APB95070.1| ribosomal protein S18 (plastid) [Daucus crinitus] gb|APB95155.1| ribosomal protein S18 (plastid) [Daucus crinitus] gb|APB95240.1| ribosomal protein S18 (plastid) [Daucus tenuisectus] gb|APB95325.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95410.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95495.1| ribosomal protein S18 (plastid) [Daucus littoralis] gb|APB95580.1| ribosomal protein S18 (plastid) [Daucus glochidiatus] gb|APB95665.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95750.1| ribosomal protein S18 (plastid) [Daucus guttatus] gb|APB95835.1| ribosomal protein S18 (plastid) [Daucus setulosus] gb|APB95920.1| ribosomal protein S18 (plastid) [Daucus setulosus] gb|APB96175.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96260.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96344.1| ribosomal protein S18 (plastid) [Daucus conchitae] gb|APB96429.1| ribosomal protein S18 (plastid) [Daucus involucratus] gb|APB96514.1| ribosomal protein S18 (plastid) [Daucus involucratus] gb|APB96684.1| ribosomal protein S18 (plastid) [Oenanthe virgata] gb|APH07287.1| ribosomal protein S18 (chloroplast) [Arracacia xanthorrhiza] gb|ATL63037.1| ribosomal protein S18 (chloroplast) [Angelica nitida] Length = 101 Score = 191 bits (486), Expect = 1e-54 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >ref|YP_009379635.1| ribosomal protein S18 (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81868.1| ribosomal protein S18 (chloroplast) [Hydrangea hydrangeoides] Length = 101 Score = 191 bits (485), Expect = 2e-54 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILS LPFLNNEKQFERTESTTRT GLRTRNK Sbjct: 61 LITIAIKQARILSSLPFLNNEKQFERTESTTRTTGLRTRNK 101 >ref|YP_009459634.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] gb|ALJ01923.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] gb|AUT13280.1| ribosomal protein S18 (chloroplast) [Scrophularia dentata] Length = 101 Score = 191 bits (485), Expect = 2e-54 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLRTR K Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTGLRTRTK 101 >ref|YP_007507133.1| ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] ref|YP_009144536.1| ribosomal protein S18 (chloroplast) [Salvia rosmarinus] ref|YP_009270934.1| ribosomal protein S18 (chloroplast) [Perilla setoyensis] ref|YP_009270758.1| ribosomal protein S18 (chloroplast) [Perilla citriodora] ref|YP_009270846.1| ribosomal protein S18 (chloroplast) [Perilla frutescens] ref|YP_009327409.1| ribosomal protein S18 (chloroplast) [Mentha longifolia] ref|YP_009471845.1| ribosomal protein S18 (chloroplast) [Mentha spicata] gb|AFQ30951.1| ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] emb|CCQ71642.1| ribosomal protein S18 (chloroplast) [Salvia miltiorrhiza] gb|AKJ76768.1| ribosomal protein S18 (chloroplast) [Salvia rosmarinus] gb|AKJ77730.1| ribosomal protein S18 (chloroplast) [Perilla frutescens] gb|AKZ24369.1| ribosomal protein S18 (plastid) [Nepeta cataria] gb|AKZ24370.1| ribosomal protein S18 (plastid) [Salvia nemorosa] gb|AMR74130.1| ribosomal protein S18 (chloroplast) [Perilla frutescens] gb|AMR74218.1| ribosomal protein S18 (chloroplast) [Perilla frutescens var. acuta] gb|AMR74306.1| ribosomal protein S18 (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74394.1| ribosomal protein S18 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74482.1| ribosomal protein S18 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74570.1| ribosomal protein S18 (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74658.1| ribosomal protein S18 (chloroplast) [Perilla citriodora] gb|AMR74746.1| ribosomal protein S18 (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74834.1| ribosomal protein S18 (chloroplast) [Perilla setoyensis] gb|AOW32173.1| ribosomal protein S18 (chloroplast) [Mentha longifolia] gb|AVI16409.1| ribosomal protein S18 (chloroplast) [Mentha spicata] Length = 101 Score = 191 bits (485), Expect = 2e-54 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFER ESTTRT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERIESTTRTTGLRTRNK 101 >ref|YP_009294885.1| ribosomal protein S18 (plastid) [Veronica nakaiana] ref|YP_009305571.1| ribosomal protein S18 (plastid) [Veronica persica] gb|AKZ24374.1| ribosomal protein S18 (plastid) [Veronica americana] gb|ANA57556.1| ribosomal protein S18 (plastid) [Veronica nakaiana] gb|ANA57644.1| ribosomal protein S18 (plastid) [Veronica persica] Length = 101 Score = 191 bits (484), Expect = 3e-54 Identities = 98/101 (97%), Positives = 100/101 (99%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVN+LTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNKLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTEST+RT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTSRTTGLRTRNK 101 >gb|APB94050.1| ribosomal protein S18 (plastid) [Daucus carota subsp. gummifer] Length = 101 Score = 190 bits (483), Expect = 4e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKI+SRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKIVSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >ref|YP_009338448.1| ribosomal protein S18 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36543.1| ribosomal protein S18 (chloroplast) [Pterygopleurum neurophyllum] Length = 101 Score = 190 bits (483), Expect = 4e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTT+T GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTKTAGLRARNK 101 >ref|YP_009232851.1| ribosomal protein S18 (chloroplast) [Angelica dahurica] ref|YP_009367025.1| ribosomal protein S18 (plastid) [Actaea racemosa] gb|AMA97943.1| ribosomal protein S18 (chloroplast) [Angelica dahurica] Length = 101 Score = 190 bits (483), Expect = 4e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFR+RLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRKRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >ref|YP_009232766.1| ribosomal protein S18 (chloroplast) [Angelica acutiloba] gb|AMA97857.1| ribosomal protein S18 (chloroplast) [Angelica acutiloba] Length = 101 Score = 190 bits (483), Expect = 4e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPI+SGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >ref|YP_009388792.1| ribosomal protein S18 (chloroplast) [Ocimum basilicum] gb|ARU77263.1| ribosomal protein S18 (chloroplast) [Ocimum basilicum] Length = 101 Score = 190 bits (482), Expect = 5e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFER ESTTRT GLRT+NK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERIESTTRTTGLRTKNK 101 >gb|APB96005.1| ribosomal protein S18 (plastid) [Daucus pusillus] gb|APB96090.1| ribosomal protein S18 (plastid) [Daucus pusillus] Length = 101 Score = 190 bits (482), Expect = 5e-54 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIK+ARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKRARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >gb|AKZ24382.1| ribosomal protein S18 (plastid) [Cicuta maculata] Length = 101 Score = 190 bits (482), Expect = 5e-54 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRR NRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRANRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTESTTRT GLR RNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTAGLRARNK 101 >gb|ADD30019.1| ribosomal protein S18 (chloroplast) [Heuchera sanguinea] gb|ALB78390.1| ribosomal protein S18 (chloroplast) [Heuchera parviflora var. saurensis] Length = 101 Score = 190 bits (482), Expect = 5e-54 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFERTEST RT G RTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTARTTGFRTRNK 101 >ref|YP_009462452.1| ribosomal protein S18 (chloroplast) [Syringa vulgaris] gb|AUT85302.1| ribosomal protein S18 (chloroplast) [Syringa vulgaris] Length = 101 Score = 189 bits (481), Expect = 7e-54 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEK FERTEST RT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKHFERTESTARTTGLRTRNK 101 >gb|ADD30002.1| ribosomal protein S18 (chloroplast) [Aucuba japonica] Length = 101 Score = 189 bits (481), Expect = 7e-54 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 539 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 360 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRPFLKSKRSFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 359 LITIAIKQARILSLLPFLNNEKQFERTESTTRTMGLRTRNK 237 LITIAIKQARILSLLPFLNNEKQFER EST RT GLRTRNK Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERAESTARTTGLRTRNK 101