BLASTX nr result
ID: Rehmannia31_contig00013216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00013216 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088608.1| basic leucine zipper 23 isoform X2 [Sesamum ... 70 4e-11 ref|XP_020551600.1| basic leucine zipper 23 isoform X1 [Sesamum ... 66 2e-09 gb|PIN19155.1| hypothetical protein CDL12_08154 [Handroanthus im... 61 1e-07 ref|XP_012837186.1| PREDICTED: uncharacterized protein LOC105957... 58 1e-06 >ref|XP_011088608.1| basic leucine zipper 23 isoform X2 [Sesamum indicum] Length = 287 Score = 70.5 bits (171), Expect = 4e-11 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -3 Query: 563 CGFDNLQCLGNQNSDQKELADRGIRD-NVLSNVNTSGNSKRKGSRSAIAS 417 CGFDNLQCLGNQ+SDQKEL D G+ + NV+S NTS +SKRKG R+A+AS Sbjct: 238 CGFDNLQCLGNQSSDQKELPDCGLGNANVVSGGNTSSSSKRKGGRAAMAS 287 >ref|XP_020551600.1| basic leucine zipper 23 isoform X1 [Sesamum indicum] ref|XP_020551601.1| basic leucine zipper 23 isoform X1 [Sesamum indicum] Length = 288 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 2/51 (3%) Frame = -3 Query: 563 CGFDNLQCLGNQNSDQKELADRGIRD-NVLSNVNTSGNSKRK-GSRSAIAS 417 CGFDNLQCLGNQ+SDQKEL D G+ + NV+S NTS +SKRK G R+A+AS Sbjct: 238 CGFDNLQCLGNQSSDQKELPDCGLGNANVVSGGNTSSSSKRKAGGRAAMAS 288 >gb|PIN19155.1| hypothetical protein CDL12_08154 [Handroanthus impetiginosus] Length = 288 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -3 Query: 563 CGFDNLQCLGNQNSDQKELADRGIRD-NVLSNVNTSGNSKRK-GSRSAIAS 417 CGFDNLQCLGNQ ++ KEL D G+ + N++S NTS +SKRK G R+A+AS Sbjct: 238 CGFDNLQCLGNQTAEVKELQDCGLDNVNIVSTANTSSSSKRKAGGRAAMAS 288 >ref|XP_012837186.1| PREDICTED: uncharacterized protein LOC105957771 [Erythranthe guttata] gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata] Length = 288 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 563 CGFDNLQCLGNQNSDQKELADRGIRD-NVLSNVNTSGNSKRKG-SRSAIAS 417 CGFD+LQCLGNQNS+ EL D G + N+ SN NTS +SK+KG +R+A AS Sbjct: 238 CGFDDLQCLGNQNSNPMELPDCGFDNVNIASNANTSSSSKKKGRARAAGAS 288