BLASTX nr result
ID: Rehmannia31_contig00013206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00013206 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA59722.1| hypothetical protein AQUCO_00400548v1 [Aquilegia ... 52 9e-06 gb|PIA59724.1| hypothetical protein AQUCO_00400550v1 [Aquilegia ... 52 1e-05 >gb|PIA59722.1| hypothetical protein AQUCO_00400548v1 [Aquilegia coerulea] Length = 116 Score = 52.4 bits (124), Expect = 9e-06 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -1 Query: 480 EVFYATQLSYALVNLRPVVPGHILF--SVHFKWS--FDEYLYG 364 EVFY TQLSYA+VNLRP+VPGHIL+ H W F+ Y++G Sbjct: 59 EVFYTTQLSYAMVNLRPLVPGHILYIDVCHLFWGIHFEIYVHG 101 >gb|PIA59724.1| hypothetical protein AQUCO_00400550v1 [Aquilegia coerulea] Length = 117 Score = 52.4 bits (124), Expect = 1e-05 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -1 Query: 480 EVFYATQLSYALVNLRPVVPGHILF--SVHFKWS--FDEYLYG 364 EVFY TQLSYA+VNLRP+VPGHIL+ H W F+ Y++G Sbjct: 60 EVFYTTQLSYAMVNLRPLVPGHILYIDVCHLFWGIHFEIYVHG 102