BLASTX nr result
ID: Rehmannia31_contig00012816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012816 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086938.1| coiled-coil domain-containing protein 12 [Se... 67 4e-11 gb|PIN10717.1| hypothetical protein CDL12_16679 [Handroanthus im... 57 1e-07 gb|KZN02652.1| hypothetical protein DCAR_011406 [Daucus carota s... 54 1e-06 ref|XP_022841602.1| coiled-coil domain-containing protein 12 iso... 54 2e-06 ref|XP_022841601.1| coiled-coil domain-containing protein 12 iso... 54 2e-06 ref|XP_017238886.1| PREDICTED: coiled-coil domain-containing pro... 54 2e-06 emb|CDP18672.1| unnamed protein product [Coffea canephora] 54 2e-06 gb|OVA07409.1| mRNA splicing factor [Macleaya cordata] 53 4e-06 ref|XP_012829255.1| PREDICTED: coiled-coil domain-containing pro... 53 5e-06 gb|PHT79817.1| hypothetical protein T459_17869 [Capsicum annuum] 52 7e-06 ref|XP_018855858.1| PREDICTED: coiled-coil domain-containing pro... 51 8e-06 >ref|XP_011086938.1| coiled-coil domain-containing protein 12 [Sesamum indicum] Length = 171 Score = 66.6 bits (161), Expect = 4e-11 Identities = 33/64 (51%), Positives = 36/64 (56%) Frame = +3 Query: 189 NTPDENGLTADPQNAXXXXXXXXXXXXXXXXXXXXXXXXANVNMKFRNYLPHDKQLQEGK 368 NTPD+N TA PQN ANV+MKFRNYLPHDKQLQEGK Sbjct: 31 NTPDDNAATAKPQNVDNQQPVEQLEQEKEDEDADEDDKEANVHMKFRNYLPHDKQLQEGK 90 Query: 369 VAPP 380 +APP Sbjct: 91 LAPP 94 >gb|PIN10717.1| hypothetical protein CDL12_16679 [Handroanthus impetiginosus] gb|PIN24848.1| hypothetical protein CDL12_02429 [Handroanthus impetiginosus] Length = 172 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 189 NTPDENGLTADPQ--NAXXXXXXXXXXXXXXXXXXXXXXXXANVNMKFRNYLPHDKQLQE 362 NTPD++ L A P ++ ANVNMKFRNYLPHDKQLQE Sbjct: 31 NTPDDDALPAGPPVADSQQPQEQLEQQKEDEDVIEGEDQEEANVNMKFRNYLPHDKQLQE 90 Query: 363 GKVAPP 380 GK+APP Sbjct: 91 GKLAPP 96 >gb|KZN02652.1| hypothetical protein DCAR_011406 [Daucus carota subsp. sativus] Length = 151 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDKQLQEGK+APP Sbjct: 60 NVNMKFRNYLPHDKQLQEGKLAPP 83 >ref|XP_022841602.1| coiled-coil domain-containing protein 12 isoform X2 [Olea europaea var. sylvestris] Length = 158 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDKQLQEGK+APP Sbjct: 57 NVNMKFRNYLPHDKQLQEGKLAPP 80 >ref|XP_022841601.1| coiled-coil domain-containing protein 12 isoform X1 [Olea europaea var. sylvestris] Length = 161 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDKQLQEGK+APP Sbjct: 60 NVNMKFRNYLPHDKQLQEGKLAPP 83 >ref|XP_017238886.1| PREDICTED: coiled-coil domain-containing protein 12 [Daucus carota subsp. sativus] Length = 163 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDKQLQEGK+APP Sbjct: 60 NVNMKFRNYLPHDKQLQEGKLAPP 83 >emb|CDP18672.1| unnamed protein product [Coffea canephora] Length = 174 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDKQLQEG+VAPP Sbjct: 75 NVNMKFRNYLPHDKQLQEGRVAPP 98 >gb|OVA07409.1| mRNA splicing factor [Macleaya cordata] Length = 156 Score = 53.1 bits (126), Expect = 4e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 N+NMKFRNYLPHDKQLQEGK+APP Sbjct: 54 NLNMKFRNYLPHDKQLQEGKLAPP 77 >ref|XP_012829255.1| PREDICTED: coiled-coil domain-containing protein 12 [Erythranthe guttata] gb|EYU17804.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata] gb|EYU17805.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata] Length = 166 Score = 53.1 bits (126), Expect = 5e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 309 NVNMKFRNYLPHDKQLQEGKVAPP 380 NVNMKFRNYLPHDK+LQEGK+APP Sbjct: 65 NVNMKFRNYLPHDKELQEGKLAPP 88 >gb|PHT79817.1| hypothetical protein T459_17869 [Capsicum annuum] Length = 106 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +3 Query: 306 ANVNMKFRNYLPHDKQLQEGKVAPP 380 ++V MKFRNYLPHDKQLQEGKVAPP Sbjct: 4 SDVQMKFRNYLPHDKQLQEGKVAPP 28 >ref|XP_018855858.1| PREDICTED: coiled-coil domain-containing protein 12-like, partial [Juglans regia] Length = 102 Score = 51.2 bits (121), Expect = 8e-06 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = +3 Query: 306 ANVNMKFRNYLPHDKQLQEGKVAPP 380 +N+NMKFRNY+PHDKQLQ+GK+APP Sbjct: 19 SNLNMKFRNYVPHDKQLQDGKLAPP 43