BLASTX nr result
ID: Rehmannia31_contig00012788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012788 (333 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094749.1| pentatricopeptide repeat-containing protein ... 71 6e-12 ref|XP_022888959.1| pentatricopeptide repeat-containing protein ... 67 9e-11 ref|XP_012831937.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-10 dbj|GAV84190.1| PPR domain-containing protein/PPR_2 domain-conta... 63 4e-09 ref|XP_019077254.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-07 ref|XP_019077253.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-07 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-07 ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-07 gb|PIN13305.1| hypothetical protein CDL12_14076 [Handroanthus im... 54 4e-06 ref|XP_018835388.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 ref|XP_010696356.1| PREDICTED: pentatricopeptide repeat-containi... 54 6e-06 ref|XP_019102681.1| PREDICTED: pentatricopeptide repeat-containi... 54 6e-06 >ref|XP_011094749.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Sesamum indicum] Length = 848 Score = 70.9 bits (172), Expect = 6e-12 Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -2 Query: 332 NDVRRDKGSPAHSSLNLEEVLERSGSSQALESPT-RRPVVLQRLKVTRKSLNHWLQ 168 ND RRD+GSP HS+L LEE +RS A ESPT RRP+VLQRLKVTR+SL+ WLQ Sbjct: 782 NDTRRDQGSPTHSNLKLEE-FDRSSLPHAPESPTTRRPLVLQRLKVTRESLHRWLQ 836 >ref|XP_022888959.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Olea europaea var. sylvestris] Length = 418 Score = 67.4 bits (163), Expect = 9e-11 Identities = 34/55 (61%), Positives = 44/55 (80%) Frame = -2 Query: 332 NDVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 N+ + D +P S+L LE+ L+RSG S LESPTRRPVVLQRLK+T++SL+HWLQ Sbjct: 357 NNKKSDVENPVCSNLKLED-LKRSGPSPQLESPTRRPVVLQRLKITKESLHHWLQ 410 >ref|XP_012831937.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Erythranthe guttata] gb|EYU41644.1| hypothetical protein MIMGU_mgv1a001284mg [Erythranthe guttata] Length = 847 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -2 Query: 320 RDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 R KGS +SS ++ E +ERS S QA ESPTRRP+VLQRLKVTR+SL+HWLQ Sbjct: 783 RGKGSRMYSS-SIGETIERSESKQASESPTRRPMVLQRLKVTRESLHHWLQ 832 >dbj|GAV84190.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 846 Score = 62.8 bits (151), Expect = 4e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -2 Query: 305 PAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 P ++ NL++VL R+ S+ L SPTRRPV+LQRLKVTRKSL+HWLQ Sbjct: 793 PFNTDANLKDVLGRNRLSRELLSPTRRPVILQRLKVTRKSLHHWLQ 838 >ref|XP_019077254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X4 [Vitis vinifera] Length = 806 Score = 57.0 bits (136), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -2 Query: 329 DVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 D R + G P S + +E L R+ LES TRRP VLQR KVTRKSL+HWLQ Sbjct: 745 DKRINLGGPPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQ 798 >ref|XP_019077253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X3 [Vitis vinifera] Length = 836 Score = 57.0 bits (136), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -2 Query: 329 DVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 D R + G P S + +E L R+ LES TRRP VLQR KVTRKSL+HWLQ Sbjct: 775 DKRINLGGPPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQ 828 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Vitis vinifera] emb|CBI32618.3| unnamed protein product, partial [Vitis vinifera] Length = 842 Score = 57.0 bits (136), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -2 Query: 329 DVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 D R + G P S + +E L R+ LES TRRP VLQR KVTRKSL+HWLQ Sbjct: 781 DKRINLGGPPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQ 834 >ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Vitis vinifera] Length = 852 Score = 57.0 bits (136), Expect = 5e-07 Identities = 30/54 (55%), Positives = 35/54 (64%) Frame = -2 Query: 329 DVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 D R + G P S + +E L R+ LES TRRP VLQR KVTRKSL+HWLQ Sbjct: 791 DKRINLGGPPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQ 844 >gb|PIN13305.1| hypothetical protein CDL12_14076 [Handroanthus impetiginosus] Length = 840 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -2 Query: 329 DVRRDKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 D+ RDKG VLE S S++ E+PTRRPVVL RLK+T +SL+HWLQ Sbjct: 777 DITRDKG-----------VLEGSSSTRESEAPTRRPVVLHRLKLTGESLHHWLQ 819 >ref|XP_018835388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Juglans regia] Length = 861 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -2 Query: 296 SSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 S +NLEE++ R+ LE TRRP ++QRLK+TRKSL++WLQ Sbjct: 811 SDINLEELIGRNSLPAKLECSTRRPAIVQRLKITRKSLHYWLQ 853 >ref|XP_010696356.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Beta vulgaris subsp. vulgaris] gb|KMS97002.1| hypothetical protein BVRB_7g179510 [Beta vulgaris subsp. vulgaris] Length = 864 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 317 DKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 DK ++S L VLE+S +L++P RRP VLQRL VT+KSL+HWL+ Sbjct: 807 DKKGTSNSVLKSRSVLEKSEFPYSLDTPARRPAVLQRLLVTKKSLSHWLR 856 >ref|XP_019102681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Beta vulgaris subsp. vulgaris] Length = 872 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 317 DKGSPAHSSLNLEEVLERSGSSQALESPTRRPVVLQRLKVTRKSLNHWLQ 168 DK ++S L VLE+S +L++P RRP VLQRL VT+KSL+HWL+ Sbjct: 815 DKKGTSNSVLKSRSVLEKSEFPYSLDTPARRPAVLQRLLVTKKSLSHWLR 864