BLASTX nr result
ID: Rehmannia31_contig00012724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012724 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT14487.1| hypothetical protein POPTR_010G033600v3 [Populus ... 61 1e-08 >gb|PNT14487.1| hypothetical protein POPTR_010G033600v3 [Populus trichocarpa] Length = 125 Score = 60.8 bits (146), Expect = 1e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -1 Query: 371 NPIPSLRAFVFFGLSYGHSRLNKS*LCYP-GILRELRRHRAYS*KKVFYS 225 NP+ LR FGLSYGHSRLNKS GILRELRRHRAYS KKVF S Sbjct: 17 NPVKFLRFPPLFGLSYGHSRLNKSKSVISLGILRELRRHRAYSSKKVFSS 66