BLASTX nr result
ID: Rehmannia31_contig00012548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012548 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV47166.1| histone deacetylase 9 [Dorcoceras hygrometricum] 102 3e-22 ref|XP_022864283.1| histone deacetylase 9-like [Olea europaea va... 86 5e-19 gb|KJB35349.1| hypothetical protein B456_006G110400 [Gossypium r... 86 1e-18 ref|XP_021906992.1| histone deacetylase 9-like [Carica papaya] 87 2e-18 gb|PON38209.1| Histone deacetylase [Parasponia andersonii] 87 2e-18 gb|ACF81466.1| unknown [Zea mays] 85 3e-18 ref|XP_018851903.1| PREDICTED: histone deacetylase 9-like [Jugla... 84 5e-18 ref|XP_015580798.1| PREDICTED: histone deacetylase 9 isoform X3 ... 89 6e-18 ref|XP_023920316.1| histone deacetylase 9-like, partial [Quercus... 83 7e-18 gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythra... 89 1e-17 ref|XP_021994280.1| histone deacetylase 9 isoform X2 [Helianthus... 89 1e-17 gb|KDO51348.1| hypothetical protein CISIN_1g0130381mg, partial [... 86 1e-17 ref|XP_002529076.1| PREDICTED: histone deacetylase 9 isoform X2 ... 89 1e-17 ref|XP_023738091.1| histone deacetylase 9 [Lactuca sativa] >gi|1... 89 1e-17 gb|PIN20810.1| Histone deacetylase complex, catalytic component ... 89 1e-17 ref|XP_021994279.1| histone deacetylase 9 isoform X1 [Helianthus... 89 1e-17 ref|XP_019199596.1| PREDICTED: histone deacetylase 9 isoform X2 ... 89 1e-17 ref|XP_015580797.1| PREDICTED: histone deacetylase 9 isoform X1 ... 89 1e-17 emb|CDP06960.1| unnamed protein product [Coffea canephora] 89 1e-17 ref|XP_012838549.1| PREDICTED: histone deacetylase 9 [Erythranth... 89 1e-17 >gb|KZV47166.1| histone deacetylase 9 [Dorcoceras hygrometricum] Length = 499 Score = 102 bits (253), Expect = 3e-22 Identities = 51/71 (71%), Positives = 56/71 (78%), Gaps = 3/71 (4%) Frame = +3 Query: 285 GSRQFLLLLKN*HK-HCSIVNLCTV--RPHCRMRSKDRISYFYDGDVGNVYFGPDHPMKP 455 GS + LLLLK + SI N C+ RPH MR+KDRISYFYDGDVGNVYFGP+HPMKP Sbjct: 38 GSGRILLLLKKSGRIRTSIFNRCSSPSRPHSSMRNKDRISYFYDGDVGNVYFGPNHPMKP 97 Query: 456 HRLCMTHHLVL 488 HRLCMTHHLVL Sbjct: 98 HRLCMTHHLVL 108 >ref|XP_022864283.1| histone deacetylase 9-like [Olea europaea var. sylvestris] Length = 92 Score = 86.3 bits (212), Expect = 5e-19 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKD+I+YFYDGDVGNVYFGP HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKIAYFYDGDVGNVYFGPSHPMKPHRLCMTHHLVL 39 >gb|KJB35349.1| hypothetical protein B456_006G110400 [Gossypium raimondii] Length = 117 Score = 85.9 bits (211), Expect = 1e-18 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_021906992.1| histone deacetylase 9-like [Carica papaya] Length = 170 Score = 87.0 bits (214), Expect = 2e-18 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >gb|PON38209.1| Histone deacetylase [Parasponia andersonii] Length = 180 Score = 87.0 bits (214), Expect = 2e-18 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >gb|ACF81466.1| unknown [Zea mays] Length = 115 Score = 84.7 bits (208), Expect = 3e-18 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 M KDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_018851903.1| PREDICTED: histone deacetylase 9-like [Juglans regia] Length = 89 Score = 83.6 bits (205), Expect = 5e-18 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 M SKDRISYFYDGDVG+VYFGP+HPMKPHRLC+THHLVL Sbjct: 1 MHSKDRISYFYDGDVGSVYFGPNHPMKPHRLCVTHHLVL 39 >ref|XP_015580798.1| PREDICTED: histone deacetylase 9 isoform X3 [Ricinus communis] Length = 348 Score = 89.0 bits (219), Expect = 6e-18 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_023920316.1| histone deacetylase 9-like, partial [Quercus suber] Length = 89 Score = 83.2 bits (204), Expect = 7e-18 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKD+I+Y+YDGDVG VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKIAYYYDGDVGGVYFGPNHPMKPHRLCMTHHLVL 39 >gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata] Length = 404 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_021994280.1| histone deacetylase 9 isoform X2 [Helianthus annuus] Length = 412 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >gb|KDO51348.1| hypothetical protein CISIN_1g0130381mg, partial [Citrus sinensis] gb|KDO51349.1| hypothetical protein CISIN_1g0130381mg, partial [Citrus sinensis] Length = 209 Score = 85.9 bits (211), Expect = 1e-17 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_002529076.1| PREDICTED: histone deacetylase 9 isoform X2 [Ricinus communis] gb|EEF33320.1| histone deacetylase 1, 2, 3, putative [Ricinus communis] Length = 429 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_023738091.1| histone deacetylase 9 [Lactuca sativa] gb|PLY70540.1| hypothetical protein LSAT_1X62081 [Lactuca sativa] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >gb|PIN20810.1| Histone deacetylase complex, catalytic component RPD3 [Handroanthus impetiginosus] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_021994279.1| histone deacetylase 9 isoform X1 [Helianthus annuus] gb|OTG08816.1| putative histone deacetylase 9 [Helianthus annuus] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_019199596.1| PREDICTED: histone deacetylase 9 isoform X2 [Ipomoea nil] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_015580797.1| PREDICTED: histone deacetylase 9 isoform X1 [Ricinus communis] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >emb|CDP06960.1| unnamed protein product [Coffea canephora] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39 >ref|XP_012838549.1| PREDICTED: histone deacetylase 9 [Erythranthe guttata] gb|EYU36088.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata] Length = 430 Score = 89.0 bits (219), Expect = 1e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 372 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVL 488 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL 39