BLASTX nr result
ID: Rehmannia31_contig00012456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012456 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF26699.1| dead box ATP-dependent RNA helicase, putative [Ri... 117 4e-31 ref|XP_002535684.2| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 4e-31 gb|ACF86701.1| unknown [Zea mays] 117 4e-31 gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria ital... 117 3e-30 gb|OAO92331.1| hypothetical protein AXX17_AT5G10880 [Arabidopsis... 114 2e-29 dbj|BAH57176.1| AT5G11200 [Arabidopsis thaliana] 114 3e-29 dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] 115 5e-29 gb|PON34719.1| P-loop containing nucleoside triphosphate hydrola... 114 5e-29 gb|EPS66777.1| hypothetical protein M569_07999 [Genlisea aurea] 115 7e-29 dbj|BAD93957.1| DEAD BOX RNA helicase RH15 - like protein [Arabi... 114 7e-29 ref|XP_016728943.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 1e-28 gb|AFK43621.1| unknown [Medicago truncatula] 111 1e-28 ref|XP_021670985.1| DEAD-box ATP-dependent RNA helicase 56-like ... 117 1e-28 ref|XP_021665600.1| DEAD-box ATP-dependent RNA helicase 56 isofo... 117 1e-28 ref|XP_021597662.1| DEAD-box ATP-dependent RNA helicase 56 isofo... 117 1e-28 ref|XP_021607355.1| DEAD-box ATP-dependent RNA helicase 56-like ... 117 1e-28 ref|XP_020536382.1| DEAD-box ATP-dependent RNA helicase 56 isofo... 117 1e-28 ref|XP_020198250.1| DEAD-box ATP-dependent RNA helicase 15 isofo... 117 1e-28 ref|XP_019706945.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 1e-28 ref|XP_019710735.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 1e-28 >gb|EEF26699.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 105 Score = 117 bits (293), Expect = 4e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 48 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 105 >ref|XP_002535684.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Ricinus communis] Length = 106 Score = 117 bits (293), Expect = 4e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 49 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 106 >gb|ACF86701.1| unknown [Zea mays] Length = 106 Score = 117 bits (293), Expect = 4e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 49 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 106 >gb|KQL13994.1| hypothetical protein SETIT_025481mg [Setaria italica] Length = 180 Score = 117 bits (293), Expect = 3e-30 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 123 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 180 >gb|OAO92331.1| hypothetical protein AXX17_AT5G10880 [Arabidopsis thaliana] Length = 155 Score = 114 bits (286), Expect = 2e-29 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFV+SASDS+VLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 98 DTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS 155 >dbj|BAH57176.1| AT5G11200 [Arabidopsis thaliana] Length = 180 Score = 114 bits (286), Expect = 3e-29 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFV+SASDS+VLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 123 DTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS 180 >dbj|BAS72633.1| Os01g0549700, partial [Oryza sativa Japonica Group] Length = 231 Score = 115 bits (289), Expect = 5e-29 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 D+YLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 174 DSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 231 >gb|PON34719.1| P-loop containing nucleoside triphosphate hydrolase [Parasponia andersonii] gb|PON81434.1| Helicase, C-terminal [Trema orientalis] Length = 180 Score = 114 bits (285), Expect = 5e-29 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLN VQERFEVDIKELPEQIDTSTYMPS Sbjct: 123 DTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKELPEQIDTSTYMPS 180 >gb|EPS66777.1| hypothetical protein M569_07999 [Genlisea aurea] Length = 220 Score = 115 bits (287), Expect = 7e-29 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSA+DSDVLNQVQERFEVDIKELPEQIDT+TYMPS Sbjct: 163 DTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKELPEQIDTATYMPS 220 >dbj|BAD93957.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana] Length = 208 Score = 114 bits (286), Expect = 7e-29 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFV+SASDS+VLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 151 DTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS 208 >ref|XP_016728943.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Gossypium hirsutum] Length = 331 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 274 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 331 >gb|AFK43621.1| unknown [Medicago truncatula] Length = 106 Score = 111 bits (277), Expect = 1e-28 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSA DS+VLNQVQ RFEVDIKELPEQIDTSTYMP+ Sbjct: 49 DTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSRFEVDIKELPEQIDTSTYMPN 106 >ref|XP_021670985.1| DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Hevea brasiliensis] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_021665600.1| DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Hevea brasiliensis] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_021597662.1| DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Manihot esculenta] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_021607355.1| DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Manihot esculenta] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_020536382.1| DEAD-box ATP-dependent RNA helicase 56 isoform X3 [Jatropha curcas] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_020198250.1| DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Aegilops tauschii subsp. tauschii] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_019706945.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 [Elaeis guineensis] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >ref|XP_019710735.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Elaeis guineensis] Length = 344 Score = 117 bits (293), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -3 Query: 482 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 309 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344