BLASTX nr result
ID: Rehmannia31_contig00012437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012437 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079725.1| peptide chain release factor APG3, chloropla... 55 3e-06 gb|KZN04978.1| hypothetical protein DCAR_005815 [Daucus carota s... 52 3e-06 gb|KZV54354.1| peptide chain release factor 1-like [Dorcoceras h... 54 7e-06 >ref|XP_011079725.1| peptide chain release factor APG3, chloroplastic [Sesamum indicum] Length = 414 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 GDMETAVQSCATMEQKEILEELAESVNAMAT 95 GD+ETAVQSCATMEQKE+LEELA SV AMAT Sbjct: 384 GDIETAVQSCATMEQKELLEELAGSVGAMAT 414 >gb|KZN04978.1| hypothetical protein DCAR_005815 [Daucus carota subsp. sativus] Length = 80 Score = 51.6 bits (122), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 GDMETAVQSCATMEQKEILEELAESVNAMA 92 GD+ETAVQSCATMEQKE+LEELAES A A Sbjct: 50 GDIETAVQSCATMEQKELLEELAESAGAPA 79 >gb|KZV54354.1| peptide chain release factor 1-like [Dorcoceras hygrometricum] Length = 407 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 GDMETAVQSCATMEQKEILEELAESVNAMA 92 GD+ETA+QSC TMEQKE+LEELAESV AMA Sbjct: 377 GDIETAIQSCVTMEQKELLEELAESVGAMA 406