BLASTX nr result
ID: Rehmannia31_contig00012397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012397 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20501.1| hypothetical protein CDL12_06806 [Handroanthus im... 67 7e-12 >gb|PIN20501.1| hypothetical protein CDL12_06806 [Handroanthus impetiginosus] Length = 60 Score = 66.6 bits (161), Expect = 7e-12 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = -1 Query: 387 MAMPLFNIFNCFSEQSERAPYICEGDVCYLRDTKAFQEXXXXXXXXXXXNRIPFSQV 217 M+ PLFNI CFSE+SER+ Y+CEGDVCYLR++KA Q RIPF +V Sbjct: 1 MSKPLFNILRCFSERSERSQYVCEGDVCYLRNSKASQGSDLKKNDQKFSIRIPFYRV 57