BLASTX nr result
ID: Rehmannia31_contig00012366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012366 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841479.1| PREDICTED: nucleobase-ascorbate transporter ... 56 5e-06 >ref|XP_012841479.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Erythranthe guttata] gb|EYU34044.1| hypothetical protein MIMGU_mgv1a004592mg [Erythranthe guttata] Length = 519 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +3 Query: 171 LSRLSSDVKVLKDFPIFERFAVLVCVVIIWIYALVL 278 LS+ VK++++FPIFERF+VLVCV+IIWIY+L+L Sbjct: 194 LSQYMKHVKIVREFPIFERFSVLVCVIIIWIYSLIL 229