BLASTX nr result
ID: Rehmannia31_contig00012351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012351 (675 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY31642.1| Branched-chain alpha-keto acid decarboxylase E1 b... 65 5e-09 gb|EYU39281.1| hypothetical protein MIMGU_mgv1a012352mg [Erythra... 64 6e-09 ref|XP_021278647.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 7e-09 gb|EOY31643.1| Branched-chain alpha-keto acid decarboxylase E1 b... 65 7e-09 gb|PPR92656.1| hypothetical protein GOBAR_AA28016 [Gossypium bar... 65 1e-08 dbj|GAV91650.1| Transket_pyr domain-containing protein/Transketo... 65 1e-08 gb|EOY31644.1| Branched-chain alpha-keto acid decarboxylase E1 b... 65 1e-08 ref|XP_007014022.2| PREDICTED: 2-oxoisovalerate dehydrogenase su... 65 1e-08 gb|EOY31641.1| Branched-chain alpha-keto acid decarboxylase E1 b... 65 1e-08 ref|XP_021636197.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 1e-08 gb|ACU23487.1| unknown [Glycine max] 64 1e-08 ref|XP_012080827.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 1e-08 gb|PIN18624.1| Branched chain alpha-keto acid dehydrogenase E1, ... 65 1e-08 gb|EOY31645.1| Branched-chain alpha-keto acid decarboxylase E1 b... 65 1e-08 ref|XP_023927275.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 1e-08 ref|XP_019104363.1| PREDICTED: 2-oxoisovalerate dehydrogenase su... 65 1e-08 gb|EYU39280.1| hypothetical protein MIMGU_mgv1a012352mg [Erythra... 64 1e-08 ref|XP_023927274.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 2e-08 ref|XP_021729234.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 2e-08 ref|XP_021714927.1| 2-oxoisovalerate dehydrogenase subunit beta ... 65 2e-08 >gb|EOY31642.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, BETA1 isoform 2, partial [Theobroma cacao] Length = 243 Score = 65.1 bits (157), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 129 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 158 >gb|EYU39281.1| hypothetical protein MIMGU_mgv1a012352mg [Erythranthe guttata] Length = 188 Score = 63.9 bits (154), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPR+PQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 74 VVIPRNPQQAKGLLLSCIRDPNPVVFFEPK 103 >ref|XP_021278647.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial [Herrania umbratica] Length = 279 Score = 65.1 bits (157), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 179 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 208 >gb|EOY31643.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, BETA1 isoform 3 [Theobroma cacao] Length = 280 Score = 65.1 bits (157), Expect = 7e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 161 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 190 >gb|PPR92656.1| hypothetical protein GOBAR_AA28016 [Gossypium barbadense] Length = 338 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 159 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 188 >dbj|GAV91650.1| Transket_pyr domain-containing protein/Transketolase_C domain-containing protein [Cephalotus follicularis] Length = 354 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 175 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 204 >gb|EOY31644.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, BETA1 isoform 4 [Theobroma cacao] Length = 354 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 161 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 190 >ref|XP_007014022.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial [Theobroma cacao] Length = 358 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 179 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 208 >gb|EOY31641.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, BETA1 isoform 1 [Theobroma cacao] Length = 358 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 179 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 208 >ref|XP_021636197.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial [Hevea brasiliensis] Length = 362 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 183 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 212 >gb|ACU23487.1| unknown [Glycine max] Length = 206 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSP+QAKGLLLSCIRDPNPVVFFEPK Sbjct: 26 VVIPRSPRQAKGLLLSCIRDPNPVVFFEPK 55 >ref|XP_012080827.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial [Jatropha curcas] gb|KDP30628.1| hypothetical protein JCGZ_16193 [Jatropha curcas] Length = 366 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 187 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 216 >gb|PIN18624.1| Branched chain alpha-keto acid dehydrogenase E1, beta subunit [Handroanthus impetiginosus] Length = 370 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 191 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 220 >gb|EOY31645.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, BETA1 isoform 5 [Theobroma cacao] Length = 380 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 161 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 190 >ref|XP_023927275.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial isoform X3 [Quercus suber] Length = 321 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 V+IPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 180 VIIPRSPQQAKGLLLSCIRDPNPVVFFEPK 209 >ref|XP_019104363.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] Length = 330 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPRSPQQAKGLLLSCIRDPNPV+FFEPK Sbjct: 151 VVIPRSPQQAKGLLLSCIRDPNPVIFFEPK 180 >gb|EYU39280.1| hypothetical protein MIMGU_mgv1a012352mg [Erythranthe guttata] Length = 253 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VVIPR+PQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 74 VVIPRNPQQAKGLLLSCIRDPNPVVFFEPK 103 >ref|XP_023927274.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial isoform X2 [Quercus suber] gb|POE92035.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial [Quercus suber] Length = 359 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 V+IPRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 180 VIIPRSPQQAKGLLLSCIRDPNPVVFFEPK 209 >ref|XP_021729234.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like [Chenopodium quinoa] Length = 383 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VV+PRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 204 VVVPRSPQQAKGLLLSCIRDPNPVVFFEPK 233 >ref|XP_021714927.1| 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like [Chenopodium quinoa] Length = 391 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 586 VVIPRSPQQAKGLLLSCIRDPNPVVFFEPK 675 VV+PRSPQQAKGLLLSCIRDPNPVVFFEPK Sbjct: 212 VVVPRSPQQAKGLLLSCIRDPNPVVFFEPK 241