BLASTX nr result
ID: Rehmannia31_contig00012214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012214 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554355.1| TLC domain-containing protein At5g14285-like... 54 6e-06 >ref|XP_020554355.1| TLC domain-containing protein At5g14285-like [Sesamum indicum] Length = 251 Score = 54.3 bits (129), Expect = 6e-06 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = -1 Query: 153 MDASSLNFSPISNPLPLFFTGXXXXXXXXXXXXFRTWARKLRPEASSCVIS 1 MDA L + IS+PLPLFFT FR WARKL+PEASSCVIS Sbjct: 1 MDALPLKLTSISSPLPLFFTMYFILYLNAYFILFRAWARKLKPEASSCVIS 51