BLASTX nr result
ID: Rehmannia31_contig00012151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00012151 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus im... 82 9e-18 gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus im... 75 5e-15 ref|XP_008387738.1| PREDICTED: uncharacterized protein LOC103450... 52 4e-06 ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798... 51 5e-06 ref|XP_015899518.1| PREDICTED: uncharacterized protein LOC107432... 51 7e-06 >gb|PIN11201.1| hypothetical protein CDL12_16202 [Handroanthus impetiginosus] Length = 43 Score = 81.6 bits (200), Expect = 9e-18 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +2 Query: 221 MHSVPSSDLLLLTPPHVTSFYGGSSFHRLKHLHKSDRRGNLSS 349 MHSVPS+DLLLLT HVTSFYGGSSFHRLKHL KSDRRGNLSS Sbjct: 1 MHSVPSNDLLLLTRQHVTSFYGGSSFHRLKHLQKSDRRGNLSS 43 >gb|PIN11951.1| hypothetical protein CDL12_15416 [Handroanthus impetiginosus] gb|PIN15072.1| hypothetical protein CDL12_12303 [Handroanthus impetiginosus] Length = 43 Score = 74.7 bits (182), Expect = 5e-15 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 221 MHSVPSSDLLLLTPPHVTSFYGGSSFHRLKHLHKSDRRGNLSS 349 MHSVPS DL++ T PH+TSFYGGSS HRLKHL KSDRRGN+SS Sbjct: 1 MHSVPSYDLVVFTRPHLTSFYGGSSSHRLKHLQKSDRRGNISS 43 >ref|XP_008387738.1| PREDICTED: uncharacterized protein LOC103450204 isoform X2 [Malus domestica] Length = 42 Score = 51.6 bits (122), Expect = 4e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +2 Query: 221 MHSVPSSDLLLLTPPHVTSFYGGSSFHRLKHLHKSDRRGNLS 346 M SVP+ LL + P++TSF+GGS HRLK L K DRRGNLS Sbjct: 1 MPSVPTHLLLRPSVPNLTSFHGGSCSHRLKRLEKGDRRGNLS 42 >ref|XP_014629336.1| PREDICTED: uncharacterized protein LOC106798098 [Glycine max] Length = 39 Score = 51.2 bits (121), Expect = 5e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +2 Query: 230 VPSSDLLLLTPPHVTSFYGGSSFHRLKHLHKSDRRGNLS 346 +PS + L P +T F+GGSSFHRLK+L KSDRRGNLS Sbjct: 1 MPSVPVDLRLVPSLTVFHGGSSFHRLKNLEKSDRRGNLS 39 >ref|XP_015899518.1| PREDICTED: uncharacterized protein LOC107432830 [Ziziphus jujuba] Length = 42 Score = 50.8 bits (120), Expect = 7e-06 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +2 Query: 221 MHSVPSSDLLLLTPPHVTSFYGGSSFHRLKHLHKSDRRGNLS 346 M SVP LL P VTSF+G S HRLKHL K DRRGNLS Sbjct: 1 MPSVPIQLLLCPLVPSVTSFHGRSCSHRLKHLEKGDRRGNLS 42