BLASTX nr result
ID: Rehmannia31_contig00011965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00011965 (709 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022875539.1| uncharacterized protein LOC111393977 [Olea e... 60 3e-07 >ref|XP_022875539.1| uncharacterized protein LOC111393977 [Olea europaea var. sylvestris] ref|XP_022875540.1| uncharacterized protein LOC111393977 [Olea europaea var. sylvestris] Length = 207 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 6/65 (9%) Frame = +2 Query: 113 KVWAYESIPSIANLFQASMTKDKIPRMRKWKSSLTLGQNYISDILDSPNV------KVYA 274 +VWA+ESIP IAN+++ +T +++PRM +WKS+LT + I+++LD P + +V+ Sbjct: 39 QVWAFESIPQIANMYRTRLTVNELPRMCRWKSTLTPNSHDIAEVLDDPQMQSSGTARVHQ 98 Query: 275 HLTPS 289 H P+ Sbjct: 99 HSIPT 103