BLASTX nr result
ID: Rehmannia31_contig00011904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00011904 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019193471.1| PREDICTED: tRNA dimethylallyltransferase 9 [... 55 4e-06 gb|KZV20220.1| tRNA dimethylallyltransferase 9-like [Dorcoceras ... 55 5e-06 ref|XP_020549959.1| tRNA dimethylallyltransferase 9 isoform X2 [... 54 9e-06 ref|XP_011082747.1| tRNA dimethylallyltransferase 9 isoform X1 [... 54 9e-06 gb|EYU45006.1| hypothetical protein MIMGU_mgv1a0264152mg, partia... 54 1e-05 >ref|XP_019193471.1| PREDICTED: tRNA dimethylallyltransferase 9 [Ipomoea nil] ref|XP_019193472.1| PREDICTED: tRNA dimethylallyltransferase 9 [Ipomoea nil] Length = 461 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +3 Query: 237 NWTKVVVEFVIKAGDPGV*SLAVDDWYKLHHRLEMLKLAGFYTSNFNL 380 NW + VE V+KAGDPGV SLA +DWY+L RLE++K +G S F + Sbjct: 189 NW-EAAVELVVKAGDPGVKSLAANDWYRLRRRLEIIKSSGLSPSAFEV 235 >gb|KZV20220.1| tRNA dimethylallyltransferase 9-like [Dorcoceras hygrometricum] Length = 925 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +3 Query: 255 VEFVIKAGDPGV*SLAVDDWYKLHHRLEMLKLAGFYTSNFNL 380 V+ V+KAGDPGV SLA +DWY+L R E+LKL+G +S+F L Sbjct: 202 VQLVVKAGDPGVQSLAANDWYRLRRRFEILKLSGASSSSFPL 243 >ref|XP_020549959.1| tRNA dimethylallyltransferase 9 isoform X2 [Sesamum indicum] Length = 452 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 255 VEFVIKAGDPGV*SLAVDDWYKLHHRLEMLKLAGFYTSNFNL 380 V+FV+KAGDPGV SLA +DWY+L RLE+LK +G S F + Sbjct: 198 VQFVVKAGDPGVQSLAANDWYRLRRRLEILKSSGASPSAFQV 239 >ref|XP_011082747.1| tRNA dimethylallyltransferase 9 isoform X1 [Sesamum indicum] Length = 464 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 255 VEFVIKAGDPGV*SLAVDDWYKLHHRLEMLKLAGFYTSNFNL 380 V+FV+KAGDPGV SLA +DWY+L RLE+LK +G S F + Sbjct: 198 VQFVVKAGDPGVQSLAANDWYRLRRRLEILKSSGASPSAFQV 239 >gb|EYU45006.1| hypothetical protein MIMGU_mgv1a0264152mg, partial [Erythranthe guttata] Length = 282 Score = 53.9 bits (128), Expect = 1e-05 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +3 Query: 255 VEFVIKAGDPGV*SLAVDDWYKLHHRLEMLKLAGFYTSNFNL 380 ++ V+KAGDPGV SLA +DWY+L RLE+LKL+G S F + Sbjct: 22 LDLVVKAGDPGVRSLAANDWYRLRRRLEILKLSGASPSTFQV 63