BLASTX nr result
ID: Rehmannia31_contig00011799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00011799 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828984.1| PREDICTED: pre-mRNA-splicing factor CWC22 ho... 70 4e-11 ref|XP_011090388.1| pre-mRNA-splicing factor CWC22 homolog [Sesa... 67 4e-10 gb|PIN18952.1| hypothetical protein CDL12_08355 [Handroanthus im... 58 7e-07 ref|XP_022879061.1| pre-mRNA-splicing factor CWC22 homolog [Olea... 58 7e-07 gb|KZV49715.1| hypothetical protein F511_30047 [Dorcoceras hygro... 56 2e-06 >ref|XP_012828984.1| PREDICTED: pre-mRNA-splicing factor CWC22 homolog [Erythranthe guttata] gb|EYU18022.1| hypothetical protein MIMGU_mgv1a001427mg [Erythranthe guttata] Length = 822 Score = 70.1 bits (170), Expect = 4e-11 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -2 Query: 157 NESEVERISLSTKGDDKENDTTKVQKPEGKVGIDAVANLGRSGGVYIPPFKL 2 NESEVE L T GD KEND KVQ VG+D VAN+GRSGGVYIPPFKL Sbjct: 213 NESEVEAKGLKTNGDGKENDAVKVQP---NVGMDVVANMGRSGGVYIPPFKL 261 >ref|XP_011090388.1| pre-mRNA-splicing factor CWC22 homolog [Sesamum indicum] Length = 858 Score = 67.0 bits (162), Expect = 4e-10 Identities = 35/52 (67%), Positives = 37/52 (71%) Frame = -2 Query: 157 NESEVERISLSTKGDDKENDTTKVQKPEGKVGIDAVANLGRSGGVYIPPFKL 2 N SEVE L+ KGD ND KV KP G V +D VANLGRSGGVYIPPFKL Sbjct: 240 NGSEVENTGLNKKGDG--NDVPKVIKPVGNVAVDEVANLGRSGGVYIPPFKL 289 >gb|PIN18952.1| hypothetical protein CDL12_08355 [Handroanthus impetiginosus] Length = 817 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 109 KENDTTKVQKPEGKVGIDAVANLGRSGGVYIPPFKL 2 KE+ KVQ PEG V +DAV NLGRSGGVYIPPFKL Sbjct: 244 KEHVAPKVQNPEGNVRVDAVPNLGRSGGVYIPPFKL 279 >ref|XP_022879061.1| pre-mRNA-splicing factor CWC22 homolog [Olea europaea var. sylvestris] ref|XP_022879062.1| pre-mRNA-splicing factor CWC22 homolog [Olea europaea var. sylvestris] ref|XP_022879063.1| pre-mRNA-splicing factor CWC22 homolog [Olea europaea var. sylvestris] ref|XP_022879064.1| pre-mRNA-splicing factor CWC22 homolog [Olea europaea var. sylvestris] Length = 877 Score = 57.8 bits (138), Expect = 7e-07 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -2 Query: 157 NESEVERISLSTK-GDDKENDTTKVQKPEGKVGIDAVANLGRSGGVYIPPFKL 2 NES+ E LS K GD K ++ KVQKPE G NLGRSGGVYIPPFKL Sbjct: 255 NESKEEDRGLSKKQGDVKAHEDIKVQKPEANSGTGMPMNLGRSGGVYIPPFKL 307 >gb|KZV49715.1| hypothetical protein F511_30047 [Dorcoceras hygrometricum] Length = 815 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -2 Query: 148 EVERISLSTKGDD-KENDTTKVQKPEGKVGIDAVANLGRSGGVYIPPFKL 2 +VE +++ K +D + + KV+KP+ KVG D ANLGRSGGVYIPPFKL Sbjct: 210 KVESRNMTKKEEDVRSTEGHKVEKPKEKVGTDMAANLGRSGGVYIPPFKL 259