BLASTX nr result
ID: Rehmannia31_contig00011172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00011172 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022875612.1| 60S ribosomal protein L13-1-like [Olea europ... 86 5e-18 ref|XP_022890440.1| 60S ribosomal protein L13-1-like [Olea europ... 84 1e-17 ref|XP_011084605.1| 60S ribosomal protein L13-1 [Sesamum indicum] 85 1e-17 ref|XP_011075827.1| 60S ribosomal protein L13-1-like [Sesamum in... 84 2e-17 ref|XP_022890441.1| 60S ribosomal protein L13-1 [Olea europaea v... 84 3e-17 ref|XP_022891773.1| 60S ribosomal protein L13-1-like [Olea europ... 84 3e-17 gb|PIN03454.1| 60S Ribosomal protein L13 [Handroanthus impetigin... 82 2e-16 gb|KZV41078.1| hypothetical protein F511_14054 [Dorcoceras hygro... 82 2e-16 ref|XP_012843885.1| PREDICTED: 60S ribosomal protein L13-1-like ... 82 2e-16 gb|PIN02784.1| 60S Ribosomal protein L13 [Handroanthus impetigin... 82 2e-16 ref|XP_018831130.1| PREDICTED: 60S ribosomal protein L13-1-like ... 81 5e-16 ref|XP_022859049.1| 60S ribosomal protein L13-1-like [Olea europ... 80 6e-16 ref|XP_023875912.1| 60S ribosomal protein L13-1 [Quercus suber] 79 2e-15 emb|CDP19062.1| unnamed protein product [Coffea canephora] 79 2e-15 ref|XP_019170602.1| PREDICTED: 60S ribosomal protein L13-1 [Ipom... 79 2e-15 ref|XP_012858637.1| PREDICTED: 60S ribosomal protein L13-1 [Eryt... 79 2e-15 ref|XP_006342488.1| PREDICTED: 60S ribosomal protein L13-1-like ... 79 3e-15 ref|XP_021827685.1| 60S ribosomal protein L13-1 [Prunus avium] 79 3e-15 gb|POE81832.1| 60s ribosomal protein l13-1 [Quercus suber] 79 4e-15 ref|XP_023902142.1| 60S ribosomal protein L13-1-like [Quercus su... 78 7e-15 >ref|XP_022875612.1| 60S ribosomal protein L13-1-like [Olea europaea var. sylvestris] ref|XP_022875620.1| 60S ribosomal protein L13-1-like [Olea europaea var. sylvestris] Length = 207 Score = 85.9 bits (211), Expect = 5e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVREKPTVELVKVT EMKSFKAYDKLR+ERTNARHVGV Sbjct: 151 GPYLPIVREKPTVELVKVTDEMKSFKAYDKLRIERTNARHVGV 193 >ref|XP_022890440.1| 60S ribosomal protein L13-1-like [Olea europaea var. sylvestris] Length = 174 Score = 84.0 bits (206), Expect = 1e-17 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVREKPTVELVKVT EMKSFKAYDKLR+ERTN RHVGV Sbjct: 118 GPYLPIVREKPTVELVKVTDEMKSFKAYDKLRIERTNKRHVGV 160 >ref|XP_011084605.1| 60S ribosomal protein L13-1 [Sesamum indicum] Length = 207 Score = 84.7 bits (208), Expect = 1e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 SGPYLPIVREKPTVELVKVT +MKSFKAYDKLRLERTN RHVGV Sbjct: 150 SGPYLPIVREKPTVELVKVTEDMKSFKAYDKLRLERTNERHVGV 193 >ref|XP_011075827.1| 60S ribosomal protein L13-1-like [Sesamum indicum] ref|XP_020548910.1| 60S ribosomal protein L13-1-like [Sesamum indicum] Length = 207 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 SGPYLPIVREKPTVELVKVT EMKSFKAY+KLRLERTN RHVGV Sbjct: 150 SGPYLPIVREKPTVELVKVTDEMKSFKAYNKLRLERTNERHVGV 193 >ref|XP_022890441.1| 60S ribosomal protein L13-1 [Olea europaea var. sylvestris] Length = 207 Score = 84.0 bits (206), Expect = 3e-17 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVREKPTVELVKVT EMKSFKAYDKLR+ERTN RHVGV Sbjct: 151 GPYLPIVREKPTVELVKVTDEMKSFKAYDKLRIERTNKRHVGV 193 >ref|XP_022891773.1| 60S ribosomal protein L13-1-like [Olea europaea var. sylvestris] Length = 213 Score = 84.0 bits (206), Expect = 3e-17 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVREKPTVELVKVT EMKSFKAYDKLR+ERTN RHVGV Sbjct: 157 GPYLPIVREKPTVELVKVTDEMKSFKAYDKLRIERTNKRHVGV 199 >gb|PIN03454.1| 60S Ribosomal protein L13 [Handroanthus impetiginosus] Length = 207 Score = 82.0 bits (201), Expect = 2e-16 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 SGPY+PIVREKPT+ELVKVT E+KSFKAYDKLRLER N RHVGV Sbjct: 150 SGPYMPIVREKPTIELVKVTNELKSFKAYDKLRLERMNERHVGV 193 >gb|KZV41078.1| hypothetical protein F511_14054 [Dorcoceras hygrometricum] Length = 207 Score = 82.0 bits (201), Expect = 2e-16 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 +GPYLPI REKPTVELVKVT +MKSFKAY+KLRLERTNARHVGV Sbjct: 150 AGPYLPIAREKPTVELVKVTEDMKSFKAYNKLRLERTNARHVGV 193 >ref|XP_012843885.1| PREDICTED: 60S ribosomal protein L13-1-like [Erythranthe guttata] gb|EYU45361.1| hypothetical protein MIMGU_mgv1a013891mg [Erythranthe guttata] Length = 207 Score = 82.0 bits (201), Expect = 2e-16 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 SGP LPIV EKP+VELVKVT EMKSFKAYDKLRLERTNARHVGV Sbjct: 150 SGPILPIVHEKPSVELVKVTSEMKSFKAYDKLRLERTNARHVGV 193 >gb|PIN02784.1| 60S Ribosomal protein L13 [Handroanthus impetiginosus] Length = 207 Score = 81.6 bits (200), Expect = 2e-16 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 +GPYLPIVREKPTVELVKVT E+KSFKAYDKLRLER N RHVGV Sbjct: 150 AGPYLPIVREKPTVELVKVTEELKSFKAYDKLRLERVNERHVGV 193 >ref|XP_018831130.1| PREDICTED: 60S ribosomal protein L13-1-like [Juglans regia] ref|XP_018831131.1| PREDICTED: 60S ribosomal protein L13-1-like [Juglans regia] ref|XP_018831132.1| PREDICTED: 60S ribosomal protein L13-1-like [Juglans regia] Length = 208 Score = 80.9 bits (198), Expect = 5e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVRE+P+VELVK+T EMKSFKAYDKLR+ERTN RHVGV Sbjct: 152 GPYLPIVRERPSVELVKITEEMKSFKAYDKLRIERTNTRHVGV 194 >ref|XP_022859049.1| 60S ribosomal protein L13-1-like [Olea europaea var. sylvestris] Length = 207 Score = 80.5 bits (197), Expect = 6e-16 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 G Y+PIVREKPTVELVKVT EMKSFKAYDKLRLERTN RHVGV Sbjct: 151 GSYMPIVREKPTVELVKVTEEMKSFKAYDKLRLERTNKRHVGV 193 >ref|XP_023875912.1| 60S ribosomal protein L13-1 [Quercus suber] Length = 207 Score = 79.3 bits (194), Expect = 2e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 GPYLPIVREKP+VELVKVT EMKSFKAYDKLRLER N RHVG Sbjct: 151 GPYLPIVREKPSVELVKVTEEMKSFKAYDKLRLERMNVRHVG 192 >emb|CDP19062.1| unnamed protein product [Coffea canephora] Length = 207 Score = 79.3 bits (194), Expect = 2e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 G Y+PI REKPTVELVKVT EMKSFKAYDKLRLERTNARHVG Sbjct: 151 GSYMPITREKPTVELVKVTQEMKSFKAYDKLRLERTNARHVG 192 >ref|XP_019170602.1| PREDICTED: 60S ribosomal protein L13-1 [Ipomoea nil] Length = 206 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 GPYLPI REKP+VELVKVT EMKSFKAYDKLRLERTN RH+G Sbjct: 150 GPYLPITREKPSVELVKVTDEMKSFKAYDKLRLERTNKRHLG 191 >ref|XP_012858637.1| PREDICTED: 60S ribosomal protein L13-1 [Erythranthe guttata] gb|EYU19728.1| hypothetical protein MIMGU_mgv1a013902mg [Erythranthe guttata] Length = 207 Score = 79.0 bits (193), Expect = 2e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 SGP LPIV EKP+VELVKVT E+KSF+AYDKLRLERTNARHVGV Sbjct: 150 SGPILPIVHEKPSVELVKVTEELKSFRAYDKLRLERTNARHVGV 193 >ref|XP_006342488.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum] Length = 206 Score = 78.6 bits (192), Expect = 3e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVGV 288 GPYLPIVR++P VELVKVT EMKSFKAY KLR+ERTNARHVGV Sbjct: 150 GPYLPIVRDQPAVELVKVTDEMKSFKAYGKLRIERTNARHVGV 192 >ref|XP_021827685.1| 60S ribosomal protein L13-1 [Prunus avium] Length = 207 Score = 78.6 bits (192), Expect = 3e-15 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 419 SGPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 SGPY+PIVREKPTVELVKVT +MK+FKAYDKLR+ER N RHVG Sbjct: 150 SGPYMPIVREKPTVELVKVTNDMKAFKAYDKLRVERMNERHVG 192 >gb|POE81832.1| 60s ribosomal protein l13-1 [Quercus suber] Length = 260 Score = 79.3 bits (194), Expect = 4e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 GPYLPIVREKP+VELVKVT EMKSFKAYDKLRLER N RHVG Sbjct: 204 GPYLPIVREKPSVELVKVTEEMKSFKAYDKLRLERMNVRHVG 245 >ref|XP_023902142.1| 60S ribosomal protein L13-1-like [Quercus suber] gb|POE48452.1| 60s ribosomal protein l13-2 [Quercus suber] Length = 207 Score = 77.8 bits (190), Expect = 7e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 416 GPYLPIVREKPTVELVKVTGEMKSFKAYDKLRLERTNARHVG 291 GPYLPIVREKP++ELVKVT EMKSFKAYDKLRLER N RHVG Sbjct: 151 GPYLPIVREKPSMELVKVTEEMKSFKAYDKLRLERMNIRHVG 192